KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_0757Help
Entry
SU5_0757          CDS       T02011                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:shb00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:shb00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
873418..874833
Genome map
AA seq 471 aa AA seqDB search
MTLDSRVAAAGDLFVAVVGHQADGRRYIPQAIAQGVAAIIAEAKDEASDGEIREMHGVPV
VYLSQLNERLSALAGRFYHEPSENMRLVAVTGTNGKTTTTQLLAQWSQLLGETSAVMGTV
GNGLLGKVIPTENTTGSAVDVQHVLASLVAQGATFGAMEVSSHGLVQHRVAALKFAASVF
TNLSRDHLDYHGDMAHYEAAKWMLYSTHHHGQAIVNADDEVGRRWLASLPDAVAVSMEGH
INPNCHGRWLKAEAVEYHDRGATIRFASSWGEGEIESCLMGAFNVSNLLLALATLLALGY
PLTDLLKTAARLQPVCGRMEVFTAPGKPTVVVDYAHTPDALEKALQAARLHCAGKLWCVF
GCGGDRDKGKRPLMGAIAEEFADIVVVTDDNPRTEEPRAIINDILAGMLDAGQVRVMEGR
AEAVTNAIMQAKDNDVVLIAGKGHEDYQIVGTQRLDYSDRVTAARLLGVIA
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcgacagccgtgtggctgcggcgggcgatctctttgtggcagtggtgggtcat
caggcggacgggcgtcgatatatcccgcaggcgatagcgcaaggcgtagctgccattatt
gcagaggcgaaagacgaggcgagcgacggtgagattcgcgaaatgcacggcgtaccagtc
gtctatctcagccagctcaatgagcgtttatctgcgctggcgggccgcttttaccatgag
ccatctgaaaacatgcgtctggtggcggtgaccggcaccaatggcaagaccaccaccacc
caactactggcgcagtggagccagttgctcggcgaaaccagcgcagtgatgggaacggta
ggcaacggactgttgggtaaagtgatcccgacggagaacacaaccggttccgcagtggat
gttcagcatgtgctggccagtctggttgcgcagggcgcgaccttcggcgcgatggaagtc
tcttctcacggcctggtgcagcatcgcgtggcagcgctgaaatttgccgcctccgtgttt
actaatttgagccgcgaccatctcgactatcatggcgatatggcgcattacgaggcggca
aaatggatgctttattccacccaccatcacggtcaggcaatcgtcaacgccgatgatgaa
gttggacgccgctggctggcgtcgctacccgatgcggtcgcggtttcaatggaagggcat
atcaaccctaactgtcacggtcgttggctgaaagcggaggcggtggagtaccacgaccgc
ggagcgacgattcgttttgcttcaagctggggtgaaggcgaaatcgaaagctgcctgatg
ggcgcgtttaacgtcagcaacttactgctggcattggcgacgctgctggcgctgggctat
ccgttaacggatttgctgaaaaccgccgcgcgtttgcagccggtttgcgggcgtatggaa
gtgttcactgcgccaggcaaaccgacggtggtggtggattacgcgcacacgccggatgcg
ctggaaaaagcgttgcaggcggcgcgcctgcactgcgccggaaaattgtggtgcgtcttt
ggctgtggcggggatcgtgacaaaggtaagcgcccactcatgggggccattgccgaagaa
ttcgcggatatcgtcgtggtgactgacgataacccgcgtaccgaggagccgcgcgccatt
atcaacgatattctggccggaatgctggacgccgggcaggtcagggtaatggaaggccgc
gctgaggcggtaaccaatgccattatgcaggcaaaagacaatgacgtcgtgctgattgca
ggtaaagggcacgaggattaccagattgtcggcacgcagcgtcttgattattcagaccgc
gtgaccgcagcgcgtttgctgggggtgatcgcatga

DBGET integrated database retrieval system