KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_0788Help
Entry
SU5_0788          CDS       T02011                                 

Definition
Dihydrolipoamide acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:shb01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:shb00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:shb00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:shb00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
908787..910676
Genome map
AA seq 629 aa AA seqDB search
MAIEIKVPDIGTDEVEITEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGVVKEIKVS
VGDKTETGALIMIFDSADGAADAAPAKAEEKKEAAPTAAPAAAAAKDVHVPDIGSDEVEV
TEVMVKVGDTVEAEQSLITVEGDKASMEVPAPFAGTVKEIKVNTGDKVSTGSLIMVFEVA
GEAGAAAPAKAEAAPAAAAPAAATGVKDVNVPDIGGDEVEVTEVMVKVGDKVTAEQSLIT
VEGDKASMEVPAPFAGTVKEIKISTGDKVKTGSLIMVFEVEGAAPAAAPAKQEAAAPAPA
AKAEKPAAPAAKAEGKSEFAENDAYVHATPLIRRLAREFGVNLAKVKGTGRKGRILREDV
QAYVKDAIKRAEAAPAAAGGGIPGMLPWPKVDFSKFGEVEEVELGRIQKISGANLSRNWV
MIPHVTHFDKTDITDLEAFRKQQNAEAEKRKLDVKYTPVVFIMKAVAAALEQMPRFNSSL
SEDGQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKSVTELSRELTTISKKARDGKLTAG
EMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFVPRLMMPISLSF
DHRVIDGADGARFITIINNMLSDIRRLVM
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaagtaccggacatcgggacagatgaagttgaaatcaccgagatt
ctggtcaaagtgggcgacaaagttgaagctgaacagtcgttgatcaccgtagaaggcgac
aaagcctctatggaagtcccgtctccgcaggctggcgtcgtgaaagagatcaaagtctct
gtcggcgacaaaaccgagaccggtgcacttatcatgattttcgattccgccgacggtgca
gctgacgctgcacctgctaaggcagaagagaagaaagaagcggctccgacagcagcacct
gctgcggcagcggcgaaagacgttcacgttccggatatcggcagtgacgaagttgaagtg
actgaagtgatggtgaaagtgggcgacaccgtagaagctgaacagtcgctgatcaccgtc
gaaggcgacaaggcctctatggaagttcctgctccgtttgcaggcaccgtgaaagagatc
aaagtgaacaccggtgataaagtctctaccggctctctgattatggtcttcgaagtggcg
ggtgaagcaggcgcagcagcaccagcgaaagcggaagccgctccggctgcggctgctcca
gcagcagcgacgggcgtgaaagacgttaacgtaccggacatcggcggcgacgaagttgaa
gtcaccgaagtgatggtcaaagtcggcgataaagttaccgctgaacagtcgctgatcacc
gtagaaggcgacaaagcctctatggaagttccggctccgttcgcgggtaccgtgaaagaa
atcaagatcagcaccggcgataaagtgaaaaccggttctctgattatggtcttcgaagta
gaaggcgcagcgcctgcggccgctccggctaaacaggaagcggcggcgccggctccggcg
gcgaaagctgagaagcctgctgccccggctgcaaaagcggaaggcaaatctgagttcgct
gaaaacgacgcgtacgttcacgctactccgctgattcgccgtctggcgcgcgagtttggc
gtcaacctggcgaaagtgaaaggcaccggtcgtaaaggccgtattctgcgcgaagacgtt
caggcttacgtgaaagacgctatcaaacgcgcggaagctgcgccggctgctgcgggcggc
ggtatcccgggtatgctgccgtggccgaaagtggacttcagcaagtttggtgaagttgaa
gaagtggaactgggccgtatccagaaaatctctggcgcgaacctgagccgtaactgggtg
atgatcccgcacgttacgcacttcgacaaaaccgatatcaccgatctggaagcgttccgt
aaacagcagaacgccgaagctgagaagcgcaaactggatgtgaaatacacgccagtggtc
ttcatcatgaaagcggttgccgctgctctggaacagatgccgcgcttcaacagctctctg
tccgaagacggtcagcgtctgaccctgaagaaatacatcaacatcggcgtggcggttgat
accccgaatggcctggtggttccggtctttaaagacgtgaataagaagagcgtgaccgag
ctgtctcgtgaactgaccaccatctccaaaaaagcgcgtgatggtaagctgaccgctggc
gaaatgcagggtggttgcttcactatctccagcatcggcggcctgggaactacccacttc
gcgccgattgttaacgcgccggaagtggctatcctcggcgtttctaagtcggcgatggaa
ccggtgtggaatgggaaagagtttgtgccgcgtctgatgatgcctatctctctttccttc
gaccaccgtgtgatcgatggtgctgatggtgcgcgtttcattaccattatcaacaatatg
ttgtctgacattcgccgtctggtgatgtaa

DBGET integrated database retrieval system