KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_0832Help
Entry
SU5_0832          CDS       T02011                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:shb00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(955752..956231)
Genome map
AA seq 159 aa AA seqDB search
MTIAYIALGSNLASPLEQVNAALKAIANIPDSRIVAVSSFYRTPPLGPQDQPDYLNAAVA
LDTALAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGDEVINTDRLTVPHYDMK
NRGFMLWPLFEIAPDLIFPDGISLHQHLTHLGAAKPAHW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgcgtatatcgcgcttggcagtaatctggcctctcctctggagcaggtcaat
gccgccctgaaggctatcgccaacattcccgatagccgtatcgtcgcggtttcttcgttt
taccgcacgccgccgcttggcccacaggatcagcccgattacctgaacgccgcggtggcg
ctggataccgccctcgcccccgaagaattgcttaaccatacccagcgcattgagctgcaa
cagggtcgggtacgcaaagccgaacgctgggggccgcgcacgctggatctcgacattatg
ctgtttggcgatgaagtcattaacaccgaccgtctgaccgtaccgcactacgacatgaaa
aaccgcggttttatgctgtggccgttattcgaaatcgctcctgatctgatctttccggat
ggtatcagcctgcatcagcatctcacccatcttggtgctgcaaaacccgcccactggtaa

DBGET integrated database retrieval system