KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_0869Help
Entry
SU5_0869          CDS       T02011                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:shb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SU5_0869
Enzymes [BR:shb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     SU5_0869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1000168..1001451
Genome map
AA seq 427 aa AA seqDB search
MYKAPRRRHYQVSCAAFCFLFRFNTSGRFMKQLTILGSTGSIGCSTLDVVRHNPDSFRVI
ALVAGKNVARMAEQCLEFSPRYAVMDDTSSAEQLKIMLQQHGSRTEVLSGQQAACEMAAL
DEVGHVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDEVKRSNARLLPVDS
EHNAIFQSLPQSIQHNLGYADLEQNGVTSILLTGSGGPFRETPMCDLAAMTPDQACRHPN
WSMGRKISVDSATMMNKGLEYIEARWLFNASARQMEVLIHPQSVIHSMVRYQDGSVLAQL
GEPDMRTPIAHTMAWPNRVTSGAQPLDFCKLSALTFSAPDYQRYPCLKLAMEAFEQGQAA
TTALNAANEITVAAFLAQQIRFTDIAGLNLAVLERMDLQEPASVEDVLQVDAIAREVARK
QVIRLSR
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgtacaaagcgccgcgcagaagacattatcaggtctcctgtgcggcgttttgcttttta
ttccgtttcaacacttctggacgtttcatgaagcaattaaccattctgggctcgaccggc
tctattggttgcagcacactggacgtggtgcgccataatcctgatagcttccgcgttatc
gcgctggtggcgggtaaaaatgtcgcccgcatggcggagcagtgcctggagttctcgccg
cgttatgccgtgatggacgatacgtcgagcgcagaacagctcaaaataatgcttcagcag
catggcagccgcaccgaggttctgagcggtcagcaggctgcctgtgagatggcggcgctt
gatgaggtcgggcatgtgatggcggccattgtgggcgcggctggtttactgccgaccctg
gcggcgattcgcgcagggaagacgattctgctggcgaataaagaatcgctggtgacctgt
gggcggctgtttatggacgaagtaaaacgcagcaacgcccggcttttacccgtcgatagc
gaacataacgcgatttttcagagtttgccgcaatctattcagcataatctgggatacgct
gaccttgagcaaaatggcgtaacgtcgattttgcttaccgggtctggtggcccgtttcgt
gaaacgccaatgtgcgatctggcagcgatgacgccggatcaggcatgtcgtcatccgaac
tggtcgatggggcgaaaaatctccgtcgactccgccaccatgatgaataaaggtctggaa
tacattgaagcgcgttggttatttaatgccagcgcacgtcagatggaagtgttgatccat
ccgcaatcggtcattcattcgatggtgcgttatcaggacggcagcgtcctggcgcagctt
ggagaacctgacatgcgtacgcctattgcgcatacgatggcatggccgaatcgcgtcacg
tccggcgcgcagccgcttgatttttgcaaactcagcgcgctgacgtttagcgcgccagat
tatcagcgttatccatgcctgaagctggcgatggaggcgtttgagcaaggtcaggcggca
acgacggcgctcaatgcggcaaacgaaatcaccgttgccgcgtttctggcgcaacagatt
cgttttaccgatatcgccgggctcaatttagcggtgctggagaggatggatttacaggaa
ccggcaagcgttgaggacgtattgcaggttgacgccatcgcgcgtgaagtagcccgaaaa
caagtgatacggctctcacgctga

DBGET integrated database retrieval system