KEGG   Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_0995Help
Entry
SU5_0995          CDS       T02011                                 

Definition
Phage lysozyme (muraminidase) (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
shb  Salmonella enterica subsp. enterica serovar Heidelberg B182
Brite
Enzymes [BR:shb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     SU5_0995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1127965..1128468
Genome map
AA seq 167 aa AA seqDB search
MAMSPALRNSVIAAISGGAIAIASVLITGPGGNDGLEGVRYKPYKDVVGVLTVCYGHTGK
DIMPGKTYTEAECKALLNKDLATVARQINPYIKVDIPETTRGAIYSFVYNVGAGNFRTST
LLRKINQVDIKGACDQLRRWTYAGGKQWKGLMTRREIEREVCLWGQQ
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgtcaccggcactacgaaatagcgtaatagcggcgataagtggcggggctatt
gctatagcatctgtgttaatcactggccccggtggtaacgatggtctggaaggtgtcaga
tacaaaccatataaggacgtagttggtgtgttgactgtgtgttatggccacaccggaaaa
gacatcatgcctggtaaaacgtataccgaagcagaatgcaaagccctcctgaataaagac
cttgccacggtcgccagacaaattaacccgtacatcaaagtcgatataccggaaacaacg
cgcggcgccatttactcgttcgtctacaacgttggcgcaggcaatttcagaacatcgacg
cttcttcgcaaaataaatcaggtcgatatcaaaggtgcatgtgatcagctacgtcgctgg
acatacgctggcggtaagcaatggaaaggcctgatgactcgtcgtgagattgagcgtgaa
gtctgtttgtgggggcagcaatga

DBGET integrated database retrieval system