KEGG   Staphylothermus hellenicus: Shell_0087Help
Entry
Shell_0087        CDS       T01249                                 

Definition
glycoside hydrolase family 4
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
shc  Staphylothermus hellenicus
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:shc00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:shc00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:shc00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(74980..76383)
Genome map
AA seq 467 aa AA seqDB search
MFVVEKALPESSRIKIGIIGAGSAVWSIPVLIDIMLKKSLANADVYLMDIDLDRLKLVYG
FAKRYAEEIHSTVNFHTTTDRVEAIKDADFVINSAMAMGHSYYERMREISEKHGYYRGIN
SVEWNMVSDYHTIWGYYQFKLAMSIARDIEEYAPNAWLFDVANPVFELATLISRKTKVKI
IGLCHGHMGIKNVIRELKLPQDKVEAEMIGFNHVIWLTKFKVDGEDGYKFLDKWIVTEAE
KYWKKWRETTANPFDIDLSPAAIDMYRNYGLLPIGDTVRGGTWKYHWNLETKKKWYGPYG
GPDSEIGWAMYIAYLKMRLYEIYKAITNASRPLTLLFPPKPSGEQVIEIIDSMVTGTPRT
FQVNVLNNGSIPGIPDNVAVEMPAVIDDKGVHRKTFSPLPSKIQKYVIYPRMMRMEWALE
AFLEGGRDKLFEWLIYDPRTKSTRQVEETIDDLLKMPGNEEMAKHYS
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtggttgaaaaagctttgcctgaatcatctaggatcaaaatcggtattataggt
gctggttctgcagtatggtctattcctgtattaatagatataatgttgaagaaaagctta
gccaatgcagacgtgtatctcatggatattgatcttgaccggttaaagcttgtatatgga
tttgctaagagatatgctgaagaaatacattcaacagtaaatttccacacgactactgat
agggtagaagcgatcaaggatgctgatttcgtaataaatagtgctatggctatgggtcat
tcatattatgagagaatgagggagatcagtgagaaacacggatactatagaggaataaat
agtgttgaatggaatatggtgagcgattaccatactatttggggatactaccagttcaaa
ctcgccatgagtattgcaagggatatagaggagtatgctccaaacgcgtggttgtttgat
gtcgctaatccagtatttgaattagcaaccctaattagtagaaaaacaaaagtgaaaata
atcggcttatgccatggacacatggggattaaaaatgttatacgtgaactaaaacttccc
caggataaagtagaagctgaaatgatcgggttcaatcatgtaatttggctaacaaaattc
aaagtagacggcgaagacggctataaattcctggataaatggatagtgacagaagctgaa
aagtactggaagaaatggagggaaacaacagctaatcccttcgacatagacttatcccca
gcagctatagacatgtatagaaactatggcttgctcccaataggagatactgttagagga
ggaacatggaaatatcactggaacctggaaacaaagaagaaatggtacggaccatatgga
ggcccagactctgaaataggctgggcaatgtatattgcttatctaaaaatgagattatac
gaaatctacaaagctataactaatgcatcaagacccttaacactattattcccgcctaaa
cctagtggtgaacaagttattgaaataattgattccatggtgacaggcacacctaggact
tttcaagtcaatgtattaaacaatggatcaatacctggtatacccgataacgtagccgtt
gaaatgccggcagtaatcgatgataaaggtgttcatagaaaaacattttctccattacca
tcaaagatacagaaatacgttatatatcccaggatgatgagaatggaatgggctctagaa
gcctttctagaaggcggtagagataagttatttgagtggctaatatatgatccgagaacc
aagtctactagacaagtagaggaaacaatagatgatctattgaaaatgcctggaaacgaa
gaaatggctaaacactactcataa

DBGET integrated database retrieval system