KEGG   Staphylothermus hellenicus: Shell_0217Help
Entry
Shell_0217        CDS       T01249                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
shc  Staphylothermus hellenicus
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Shell_0217
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Shell_0217
Enzymes [BR:shc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Shell_0217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(199617..200552)
Genome map
AA seq 311 aa AA seqDB search
MSFPRGDVLSILDYSRENLEYLFSVADQMEKYLSEKKKLNLLDGYIIALAFLEPSTRTMY
SFQSATYRLGGKTLVFTSETATSLAKGENYADTIRMLDSYSDLIVIRSKYEGTARYAAEI
AENPVINGGDGRHEHPTQAMIDLYTMYKIFGGIDGLTIGILGDLKYARTIASLLYGLTRF
KPRKVYLISPGILRLREEVRNKIVELRLPFEETTSLQDVIDELDVLYVTRIQKERYPDPI
EYERVKNLYRISIDILRNVKKEFRILHPLPKIDEIDYRVDETPYAAYFYQAKLGVPLRMA
LLSLVLGVWRD
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagttttcccagaggagacgtattaagcatactggattatagccgtgaaaacttagaa
tatctcttctcagtagctgatcaaatggagaaatacttgtctgagaaaaagaagctgaat
ttgctggacggatacattattgctttagcattcctcgaaccaagcactaggacaatgtat
agttttcaatcagcaacatataggctgggcgggaaaacacttgtattcacaagtgaaaca
gctactagtctagcaaagggagaaaactatgctgacactattagaatgcttgactcatac
agtgacctaatagttattaggtcaaaatatgagggaacagctaggtacgctgcagaaata
gcggaaaaccctgtaatcaatggaggagatggtagacatgagcatccaacccaggcaatg
attgatttatacactatgtataaaatatttggaggaatagatgggttaacaataggtatt
ctaggagacctaaaatatgctaggacaatagcaagcctcctatatggtttaacaaggttt
aaaccgagaaaagtatacttgatatctcccggaatacttaggctgagagaagaggttaga
aacaaaatagttgagcttagattaccgtttgaggaaacaactagtctacaagacgttatc
gatgaactagatgtactatatgttacgagaattcagaaggagagataccctgatcccata
gagtatgagagggttaagaacctataccggataagtattgatatattgagaaatgttaag
aaagagtttagaatacttcacccactaccaaaaatagacgagatagattatagagttgat
gaaacaccttatgcagcatatttctaccaagccaagctaggggttccattgagaatggct
ctattatccctcgtactaggtgtttggagggattaa

DBGET integrated database retrieval system