KEGG   Staphylothermus hellenicus: Shell_0336Help
Entry
Shell_0336        CDS       T01249                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
shc  Staphylothermus hellenicus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:shc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Shell_0336
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Shell_0336
   00640 Propanoate metabolism
    Shell_0336
   00660 C5-Branched dibasic acid metabolism
    Shell_0336
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Shell_0336
Enzymes [BR:shc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Shell_0336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(294685..295824)
Genome map
AA seq 379 aa AA seqDB search
MKLYEFEAKEIARNNGVPVPRGNIAKTPEEARTVAEKIGGEVVLKAQVLVGRRGLAGGVL
FASNPLEAEKVARELFNKRIRGEKAQLILVEEKICIDKEYYLSLTIDRSNREIVYLVSPL
GGVEIEELVKKYPNKLLRIRVDPMIGYKSYMSRLAAKFLGLPKELWPSIHKIMNSMYNIM
KNYDADLVEFNPLVKTCSNEIVAVDAKITIDDNSLYRHPEFAEKYGRELSKLEAIAKKLG
FSYVELDGDVGIMCNGAGLTMATMDMVAYYGGRPANFLDIGGGASRERVKEAAKLLLKHD
KVKVLLINIFGGITRCDEVARGIIEAVEETGVKKPIVIRLLGTNEEIGRRLLEEKGYSVF
SEADDAVKKAVEIAKNLPR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
ttgaaactatacgagttcgaggcaaaagagatcgctagaaacaatggtgtacctgttcct
cgaggaaatattgctaaaacacctgaggaggcaagaactgttgctgagaaaatcggcggc
gaagtagtgttgaaagcacaagtactggttgggagaagaggattagcgggcggagtcttg
ttcgcatctaatcctctcgaagctgaaaaagttgctagggaactcttcaataaacgcata
cgcggtgaaaaagcacagcttatccttgtagaggagaaaatatgtattgataaagaatat
tatttatctctaaccatagatcgctccaacagggaaatagtataccttgtatcccctctg
ggaggagttgagatagaagagcttgttaagaaatacccaaataaactattgaggatcaga
gttgatccaatgattggatacaaatcatacatgtcgcgtttagcagctaaattcctaggt
ttaccgaaagagctatggcctagtatacataagataatgaattctatgtataatatcatg
aaaaactatgatgctgatcttgtagagtttaatccattggttaaaacatgtagtaacgaa
atagtagcggttgatgctaaaataacaattgacgacaacagtctttaccgccacccagaa
ttcgccgagaaatatgggagggagttatcgaaactagaagctatcgctaaaaaacttggg
ttctcctacgtagaactcgacggggatgttgggataatgtgtaatggtgctggattaact
atggcgacaatggatatggtggcatattatggtgggagaccagctaatttcctagatata
ggtggtggggcttcgcgtgagagagttaaggaggcagctaaactattattgaagcatgac
aaggttaaggtgcttctaataaatattttcggcggtataactaggtgcgatgaagtagct
agagggataattgaggctgtagaggagaccggtgttaaaaaaccaattgttattagattg
ctcggcaccaatgaggaaattggtagaagacttcttgaagaaaaaggatatagtgttttt
agcgaagcagatgatgctgttaagaaagctgttgagatagccaagaatctacctaggtga

DBGET integrated database retrieval system