KEGG   Staphylothermus hellenicus: Shell_0336Help
Entry
Shell_0336        CDS       T01249                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
shc  Staphylothermus hellenicus
Pathway
shc00020  Citrate cycle (TCA cycle)
shc00640  Propanoate metabolism
shc00720  Carbon fixation pathways in prokaryotes
shc01100  Metabolic pathways
shc01110  Biosynthesis of secondary metabolites
shc01120  Microbial metabolism in diverse environments
shc01130  Biosynthesis of antibiotics
shc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:shc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Shell_0336
   00640 Propanoate metabolism
    Shell_0336
   00660 C5-Branched dibasic acid metabolism
    Shell_0336
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Shell_0336
Enzymes [BR:shc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Shell_0336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A DUF1848 ATP-grasp CPSase_L_D2 NAD_binding_10 Peripla_BP_4 Succ_CoA_lig
Motif
Other DBs
NCBI-ProteinID: ADI31468
JGI: Shell_0336
UniProt: D7DBC1
Position
complement(294685..295824)
Genome map
AA seq 379 aa AA seqDB search
MKLYEFEAKEIARNNGVPVPRGNIAKTPEEARTVAEKIGGEVVLKAQVLVGRRGLAGGVL
FASNPLEAEKVARELFNKRIRGEKAQLILVEEKICIDKEYYLSLTIDRSNREIVYLVSPL
GGVEIEELVKKYPNKLLRIRVDPMIGYKSYMSRLAAKFLGLPKELWPSIHKIMNSMYNIM
KNYDADLVEFNPLVKTCSNEIVAVDAKITIDDNSLYRHPEFAEKYGRELSKLEAIAKKLG
FSYVELDGDVGIMCNGAGLTMATMDMVAYYGGRPANFLDIGGGASRERVKEAAKLLLKHD
KVKVLLINIFGGITRCDEVARGIIEAVEETGVKKPIVIRLLGTNEEIGRRLLEEKGYSVF
SEADDAVKKAVEIAKNLPR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
ttgaaactatacgagttcgaggcaaaagagatcgctagaaacaatggtgtacctgttcct
cgaggaaatattgctaaaacacctgaggaggcaagaactgttgctgagaaaatcggcggc
gaagtagtgttgaaagcacaagtactggttgggagaagaggattagcgggcggagtcttg
ttcgcatctaatcctctcgaagctgaaaaagttgctagggaactcttcaataaacgcata
cgcggtgaaaaagcacagcttatccttgtagaggagaaaatatgtattgataaagaatat
tatttatctctaaccatagatcgctccaacagggaaatagtataccttgtatcccctctg
ggaggagttgagatagaagagcttgttaagaaatacccaaataaactattgaggatcaga
gttgatccaatgattggatacaaatcatacatgtcgcgtttagcagctaaattcctaggt
ttaccgaaagagctatggcctagtatacataagataatgaattctatgtataatatcatg
aaaaactatgatgctgatcttgtagagtttaatccattggttaaaacatgtagtaacgaa
atagtagcggttgatgctaaaataacaattgacgacaacagtctttaccgccacccagaa
ttcgccgagaaatatgggagggagttatcgaaactagaagctatcgctaaaaaacttggg
ttctcctacgtagaactcgacggggatgttgggataatgtgtaatggtgctggattaact
atggcgacaatggatatggtggcatattatggtgggagaccagctaatttcctagatata
ggtggtggggcttcgcgtgagagagttaaggaggcagctaaactattattgaagcatgac
aaggttaaggtgcttctaataaatattttcggcggtataactaggtgcgatgaagtagct
agagggataattgaggctgtagaggagaccggtgttaaaaaaccaattgttattagattg
ctcggcaccaatgaggaaattggtagaagacttcttgaagaaaaaggatatagtgttttt
agcgaagcagatgatgctgttaagaaagctgttgagatagccaagaatctacctaggtga

DBGET integrated database retrieval system