KEGG   Staphylothermus hellenicus: Shell_0356Help
Entry
Shell_0356        CDS       T01249                                 

Definition
acetyl coenzyme A synthetase (ADP forming), alpha domain-containing protein
Orthology
K01905  
acetyl-CoA synthetase (ADP-forming) [EC:6.2.1.13]
Organism
shc  Staphylothermus hellenicus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:shc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shell_0356
   00620 Pyruvate metabolism
    Shell_0356
   00640 Propanoate metabolism
    Shell_0356
Enzymes [BR:shc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     Shell_0356
Lipid biosynthesis proteins [BR:shc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Shell_0356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
310484..311869
Genome map
AA seq 461 aa AA seqDB search
MKPLFEPRSIAVIGASRSPGKIGHTIMKNIIEYGYKGRIYPINPKADKILGYKAYKSVLE
VPDEIDMAIIVVPEQIVLKVAEECGRKGVKVLVVIASGFSEVGNIEAERKLVEIARRYGM
RVLGPNIFGITYTPAKLNATFGPKDVLEGPIAFITQSGALGIALMGWTIMEEIGISALVS
MGNMADIDVIDVSKYLAGDPNTRVITIYLEGLKPGTGRKFIEEMKKVTAKKPVIVIKAGR
SKRGAAAAASHTGSLAGSDNLYQAAFKQAGIIRAYTTEEMFDWARAFASQPLPRGEETII
ITNGGGVGVLATDAAEEHNVKLLDPSPELKEKFKKAMPWFGSARNPVDLTGQAIVENYVE
ALRIAFESGEIHNIILLYCRTAILDPRDLAKAVIKLYEEYKETNYSKPLVAGFVGGEDVR
EAVRLLNKNGIPAYPSAERAVASIAKMIWYMRYLNKIKSRK
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacccttgttcgagcctagaagtattgcggttataggggctagtaggagtccaggc
aagattggtcacactattatgaaaaacattattgaatatggctataaaggtagaatatac
cctataaaccctaaagctgacaagatacttggctataaagcatacaagtccgttcttgaa
gtgcccgacgagatagatatggcaataatagttgttcctgaacaaattgtcctgaaagtt
gctgaggaatgtggtaggaaaggtgtaaaggtactagttgttatcgcgtctggttttagc
gaagtaggaaatattgaggctgagagaaaacttgtcgaaatagcacgtaggtatggtatg
agggttcttggaccaaatattttcggaataacatatactcctgcaaaattgaatgcaaca
tttggtccaaaagatgttctcgagggtcctatagcattcattacgcaaagcggtgcttta
ggaatagcattaatgggatggacgataatggaggagataggcatatcagctcttgtcagt
atgggtaatatggcggatatagatgtaatagatgtttccaaatatttagccggcgatcca
aatactagagtcataacaatttatcttgaaggactgaaacctggtactggtagaaaattc
attgaggaaatgaagaaagttacagcgaagaaaccggtaatcgtaattaaggctggtagg
agcaaacgcggagcagcagctgctgcaagccatactgggagcctggctggaagcgataat
ttataccaagcagcattcaagcaagcaggaataattagagcatatactacagaggaaatg
tttgattgggctagagcatttgcttcacaaccattacctcgaggcgaagaaacaattatt
attacgaatggtggaggagtaggtgttttagcaactgatgcagccgaggaacacaatgtt
aaattattagatcccagccctgagcttaaggagaaattcaagaaggctatgccatggttt
ggcagtgctaggaaccctgttgatttaactggtcaagctattgttgaaaactatgtggaa
gcgttaagaatagcgtttgaatccggtgaaatccataatatcatattgttatattgtaga
acagctattctcgatcccagagacttagcgaaagccgttattaaactatatgaagaatac
aaagaaaccaattatagtaaaccattggttgcaggatttgtcggcggagaagatgttcgg
gaagcggtcaggttgttgaataagaatggcatacctgcttatccaagtgctgagagagct
gtagctagtatagctaaaatgatctggtatatgaggtatcttaataaaataaagtctagg
aaataa

DBGET integrated database retrieval system