KEGG   Staphylothermus hellenicus: Shell_0551Help
Entry
Shell_0551        CDS       T01249                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
shc  Staphylothermus hellenicus
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shc00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Shell_0551
Enzymes [BR:shc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Shell_0551
Exosome [BR:shc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Shell_0551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
503207..504781
Genome map
AA seq 524 aa AA seqDB search
MPHYILVVDQGTTGTRAVLYDDRGGVINYSYLEHCQIYPRPGWVEHDPLEIWRNTVYVLR
DAVKHSGIDPSDIVGVGVTNQRETTIVWDKATGKPIYNAIVWQDTRTTNYCKDLIEKGLY
KLVHEKTGLTISTYFSATKIKWILDNLPGARERAERGELLFGTIDTWIIWNMTRGTRDHL
TPDRGGAHVIDYSNASRTMLFDIVNHRWSSELLEEMRIPYGILPVVVPSSSRKPYGYMNK
DILGEEIPIHGDLGDQQAALVGQTCFRRGELKSTYGTGTFMLLNTGDKPVYSSRGLLTTI
GYVFEGYDPVYALEGSVAISGAAIQWLRDNLRIIRDPSETEKLAMKTGKIGSGGVYFVPA
FSGLYAPYWDMTARGLIIGLTRYTRIEHIVHAVLEATAYQVRDVYEAMINDTGIVIDKLK
VDGGATKNNYLMQLQANILGIPVLRPKNIETTSLGAAFAAGLGAGLWRNIEELRQLWVLD
KEFKPIWNKEKREKLYSGWRSAVKRAMKWLDEVGELPGSSAYKE
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
gtgcctcattatatcctcgttgttgatcagggaactactggtactagagcggttctctac
gatgataggggcggggttattaattatagttatctagagcattgccagatctatcctcgt
ccaggctgggtagagcatgatccattagagatttggaggaatacagtttatgtattgaga
gatgctgtgaagcattcaggaattgatcctagtgatatagttggtgttggtgtaactaat
cagcgggaaacaactattgtatgggataaagctacaggtaagcccatatataatgctatt
gtgtggcaagatactcgaaccactaattactgtaaggatctcattgaaaagggtttatac
aagcttgtccacgagaaaacagggttaactatttcaacatatttctcggctacaaaaata
aaatggatcctagataatttaccgggtgctcgagagagggcggagcgcggagaactatta
ttcggaactattgatacatggattatatggaacatgaccagggggacaagggatcattta
acccctgatcgtggaggagcacatgttatagattattctaatgcttctaggacaatgttg
ttcgacatagttaatcatagatggtcaagtgaattattagaggagatgaggataccatac
gggattcttccagtagttgttccgagtagttctaggaaaccatatggttatatgaataag
gatatactgggtgaagaaatacctatacatggggatctaggtgatcaacaagccgcactt
gttgggcaaacatgttttagaaggggtgaattaaaatcaacttatggtactggaacattt
atgttgttaaatactggagataaacctgtttattcatctaggggattacttactacgata
ggctatgtatttgaaggatatgatccagtatatgctcttgaaggttcagtagcaattagt
ggtgcggctattcaatggcttagagataatctcagaataattagagatccttccgaaaca
gaaaaactagctatgaagaccgggaaaataggttctggaggagtatattttgttcctgca
tttagcggattgtatgctccatactgggacatgactgctagaggattgataattggtctt
acaagatatactaggatagaacatattgttcatgcagtgctcgaggcaactgcttaccag
gtaagagacgtatatgaagccatgatcaatgatactggaatagttatagataagttaaaa
gtagatggtggtgctactaaaaacaattatcttatgcagttacaagccaacatactcgga
atacctgttctccgacctaaaaatattgaaacaacaagtttaggtgcagcattcgctgct
ggattgggagctggattatggaggaatattgaagaactacgacaattatgggttttggat
aaagagtttaaacctatatggaataaggagaaaagagagaagctatatagtggatggaga
tcagctgttaagagagctatgaaatggttagatgaagtcggagagctacccggtagtagt
gcttataaggaataa

DBGET integrated database retrieval system