KEGG   Staphylothermus hellenicus: Shell_0576Help
Entry
Shell_0576        CDS       T01249                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type II
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
shc  Staphylothermus hellenicus
Pathway
shc00010  Glycolysis / Gluconeogenesis
shc01100  Metabolic pathways
shc01110  Biosynthesis of secondary metabolites
shc01120  Microbial metabolism in diverse environments
shc01130  Biosynthesis of antibiotics
shc01200  Carbon metabolism
shc01230  Biosynthesis of amino acids
Module
shc_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:shc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shell_0576
Enzymes [BR:shc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Shell_0576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N GFO_IDH_MocA 2-Hacid_dh_C Semialdhyde_dh NAD_binding_3 Methyltransf_15 CoA_binding
Motif
Other DBs
NCBI-ProteinID: ADI31703
JGI: Shell_0576
UniProt: D7DC06
Position
complement(529709..530755)
Genome map
AA seq 348 aa AA seqDB search
MSKIRVGINGYGTIGKRIADAVARMPDMELVGVVKVTPDYGYLVAEQKGISVYTVKDRID
KFRGKGFKVEGTIEDLLEQVDIIVDATPGGYGSYYKEKYYDELIIKGKLKAIYQGGEKPD
VADISFNSYCNAEEALEANSIRVVSCNTTGLLRAICVLNNAYGIEKVRATIIRRAADPKE
DKRGPVNSIKLNPPKIPSHHALDVKTVIPNIDIETAAVIVPTTLMHVHSVYMVLKTRVDR
DEIIDELSSYNRIVVIDAEKTGIDSTAKIVESARDLLRPRYDIPELIIWKDSIFTRENEL
WFLQAVHQESIVVPENIDAIRGLARTDGYPDKSIRLTDSVLGMGKFLG
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
ttgtctaagatacgggttggtataaatggttatggaacaattgggaaaagaatagctgat
gcagtagctaggatgcctgatatggaactagtaggcgtagtcaaggtaacaccggattat
ggatacctagtagcagaacaaaagggtatatcagtctacacagtaaaggatcgtatagat
aagtttaggggtaaaggcttcaaagttgagggaacaatagaggatctattggagcaagta
gacataattgttgatgcaacacctggaggatatggttcttactataaggagaaatactat
gatgaactaattattaaaggaaaactgaaagcaatttatcaaggcggggaaaaacctgat
gtagcagatataagttttaactcgtattgcaacgctgaagaagcattagaagcgaacagt
ataagagtggtaagctgtaatactacaggcttgctcagagctatatgtgtactcaataat
gcttatggtattgaaaaggtaagagcaacaattatacggagagcagctgatcccaaggag
gataagagggggccagttaactctataaaacttaacccgccaaaaatacctagtcatcac
gcattagatgttaaaacagtaataccaaacattgacatagagacagccgcagttattgtt
ccaacgaccctaatgcatgtccactcagtatatatggtgttaaaaacaagggttgacagg
gacgaaataattgatgagctatctagttataatagaatagttgttatcgatgctgaaaaa
acaggaatcgattcaaccgcaaagatcgtcgagtcggcaagagatctgctaaggcctaga
tatgatatacccgagctgatcatatggaaagatagcatatttacaagggaaaatgagcta
tggttcttacaagcagttcaccaagaatcaattgttgtgccggaaaatatagatgctatt
agaggcttggcgagaactgatggttatccagataaaagtattaggttaactgattctgtt
ctaggaatgggaaagtttttaggataa

DBGET integrated database retrieval system