KEGG   Staphylothermus hellenicus: Shell_0640Help
Entry
Shell_0640        CDS       T01249                                 

Definition
(GenBank) Pyridoxal-5'-phosphate-dependent protein beta subunit
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
shc  Staphylothermus hellenicus
Pathway
shc00260  Glycine, serine and threonine metabolism
shc01100  Metabolic pathways
shc01110  Biosynthesis of secondary metabolites
shc01120  Microbial metabolism in diverse environments
shc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:shc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Shell_0640
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Shell_0640
Enzymes [BR:shc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Shell_0640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP HTH_11 HTH_5 HTH_24 PadR HTH_20 TrmB MarR HypA FUR LexA_DNA_bind HTH_12 zinc_ribbon_2 zf-ribbon_3
Motif
Other DBs
NCBI-ProteinID: ADI31764
JGI: Shell_0640
UniProt: D7DC67
Position
complement(595617..596924)
Genome map
AA seq 435 aa AA seqDB search
MIKIKCLKCGFENNSYRGYNCPNCGSLLEVIHGFEWIIEWGNNGIWIFSKMLPQTNHRIS
LGEGWTPLIRSDNLFRDENIYFKDESRNPTGSFRDRAAALVVSDALDQGAKRLVVASDGN
MGASIAAYSAKAGLPATIYVPVWADPEKILLMKAYGAKVIVSKEDLDTLLQYVERRTRKE
KLYNASSTYNILAMEGLKTIAYEIYLQYGGIPEAIYVPLGSGLTLLSLYHGFSEMLTNNI
IDHIPRLIGVETCANPVYSSIHGNPTRCNEEPMPGLYYRKPVLKEYVSEIIDKHGETIVV
NNKQVYEAAKKLAMKEGLFVEPSSAVALAGALKMGGVENSIILLTGHGLKGPSSYTRPSR
ERYTPFPGSTKSLILKIVSEKPGLTGYEIWKRLGLRISVQAVYQHLKELERMGLIHSKFL
ENRKVYFPSYKKSRS
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgattaagattaaatgtttgaaatgcggatttgaaaataatagttatagaggatataat
tgccctaattgtggctcgctcctcgaagtaatccatggttttgaatggattatagaatgg
ggaaataatggtatatggattttttcaaaaatgcttccacaaactaatcatagaatatca
ttgggggagggatggactccactgattagatcagataatctcttcagagatgagaatata
tatttcaaagatgagagtaggaatccaactggtagttttagagatagagcggccgcacta
gttgtgagcgatgcattagatcagggtgctaagagactggttgttgcaagcgatggaaac
atgggtgcaagcattgctgcttattcagctaaagcaggattacctgctacaatatatgtt
cctgtatgggctgatcccgaaaaaatattattaatgaaagcttatggtgcaaaagtaatt
gttagtaaagaggatctagatactctactacaatatgttgagagaagaactaggaaggaa
aaactctacaatgcatcgagtacttataatatattagctatggaaggattgaaaactatt
gcttacgaaatatatttgcagtatggaggtattcccgaagcaatatatgttccattgggt
agtggattaacacttctaagtctctatcatggattctcagaaatgctaacaaacaatatt
attgatcacatacctagacttataggtgttgaaacatgtgctaaccccgtatactcctct
atacacggtaatcctactaggtgcaatgaagaaccaatgcccggcttatactataggaag
cctgtattgaaagaatatgtttcagaaatcatagataaacatggggagaccattgttgtg
aacaacaaacaagtatatgaagcagctaagaaactcgctatgaaagagggattatttgta
gagccttcctccgctgtggcattagctggagcactaaaaatggggggagttgagaactca
ataatactgctgaccggacacggattgaaaggcccaagctcctatacgaggcctagtaga
gaaagatatactccattcccaggctcaactaaatcactaatattgaaaattgtatccgaa
aaaccaggattaacaggatacgagatatggaaaagacttggattaagaatatctgttcaa
gcagtctatcagcatcttaaggaattagaaagaatgggacttatccattctaagttcttg
gaaaataggaaggtatattttccatcatataagaaatcaaggagttga

DBGET integrated database retrieval system