KEGG   Staphylothermus hellenicus: Shell_0678Help
Entry
Shell_0678        CDS       T01249                                 

Definition
acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
shc  Staphylothermus hellenicus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:shc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Shell_0678
  Amino acid metabolism
   00300 Lysine biosynthesis
    Shell_0678
Enzymes [BR:shc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Shell_0678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(640536..641768)
Genome map
AA seq 410 aa AA seqDB search
MPKLPEWIYSLAEEILMESIKYPTVLGEAYEEIVNYYANVLKSHGIHVTIHRVPDEYVKE
KLGPEMNPDKPRYILLARIGESDKVLQFNGHYDVVFPGEGWKITDPFKPLKKNGRIYGRG
STDMKGGIAAFLAAMIYLATTKEEPPISVEAAIVPDEEIGGATGTGYLVNVLGSKPTWAV
IAEPSGLDNIWHGHKGLVWGEIVVKGKQSHGSTPWLGINAFEKMVYVAKYLIENYLPRLK
DKTSRYEYDLPEGKHPTATLGGKLSAPGSINIVPGQVSFSIDRRLIIEENTNDAIEELNK
YIVEAAKKYSADVELRIIERMEPAFTDPSSEIVEALAKAIRMDTGVEPRRTICVGGLDLR
YYSYKGIPVATYGPGEPSMPHKVDEYIEVENLHKVIDVYVDLVNILGRSS
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaattgcccgagtggatatatagtcttgcagaagaaatacttatggagagtata
aagtatccaaccgttctcggggaagcatatgaagaaattgtaaattattatgctaatgtg
ttgaagtcgcatggtatacatgtaacaattcatcgagtacccgatgaatatgttaaggaa
aaacttggccccgaaatgaatcctgataagccgagatatatcttattggcaaggataggc
gagtcggataaagtcttacagtttaatggtcattatgatgtagtatttcctggggaaggc
tggaaaatcacggatccatttaagcccctcaagaaaaatggtagaatctatggacgtgga
tctacagatatgaagggaggcatagcagccttcctagcagcaatgatatacttagcaacc
accaaggaggagccgcctataagtgttgaagcagcaattgttcctgacgaagaaataggc
ggagccactggaacagggtatttagttaatgtattgggtagtaagcctacctgggcagtc
atagctgagcccagcggcttagataacatatggcatggacataaaggacttgtatgggga
gaaatagttgttaagggtaaacagagccatggctccactccttggctaggaataaatgct
ttcgagaaaatggtttatgttgcaaaatacttgatagaaaattatctaccaagattaaag
gataaaacaagcaggtacgaatatgacttgcccgaaggcaaacacccgactgcgacgctt
ggaggaaaactatcagctccaggaagcataaatatagtgcctggacaagtatcattcagt
attgatcgcagactaataatagaggaaaatacaaatgatgcaattgaagaacttaacaaa
tacattgtggaagcagcaaagaaatatagtgccgatgttgaacttagaataattgagaga
atggagccagccttcaccgatcccagctctgaaatagttgaagcacttgcaaaagctata
cgaatggatacaggtgtggagcctaggaggacaatatgtgtcggaggactggatctaagg
tattactcgtataaggggataccggtagcaacttatggccctggagaaccgagtatgcct
cataaagttgatgaatacatagaagttgaaaacttgcataaggtaatagatgtgtacgta
gacctagttaatatacttggaagaagctcgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system