KEGG   Staphylothermus hellenicus: Shell_0678Help
Entry
Shell_0678        CDS       T01249                                 

Definition
acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
shc  Staphylothermus hellenicus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:shc01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:shc00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(640536..641768)
Genome map
AA seq 410 aa AA seqDB search
MPKLPEWIYSLAEEILMESIKYPTVLGEAYEEIVNYYANVLKSHGIHVTIHRVPDEYVKE
KLGPEMNPDKPRYILLARIGESDKVLQFNGHYDVVFPGEGWKITDPFKPLKKNGRIYGRG
STDMKGGIAAFLAAMIYLATTKEEPPISVEAAIVPDEEIGGATGTGYLVNVLGSKPTWAV
IAEPSGLDNIWHGHKGLVWGEIVVKGKQSHGSTPWLGINAFEKMVYVAKYLIENYLPRLK
DKTSRYEYDLPEGKHPTATLGGKLSAPGSINIVPGQVSFSIDRRLIIEENTNDAIEELNK
YIVEAAKKYSADVELRIIERMEPAFTDPSSEIVEALAKAIRMDTGVEPRRTICVGGLDLR
YYSYKGIPVATYGPGEPSMPHKVDEYIEVENLHKVIDVYVDLVNILGRSS
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaattgcccgagtggatatatagtcttgcagaagaaatacttatggagagtata
aagtatccaaccgttctcggggaagcatatgaagaaattgtaaattattatgctaatgtg
ttgaagtcgcatggtatacatgtaacaattcatcgagtacccgatgaatatgttaaggaa
aaacttggccccgaaatgaatcctgataagccgagatatatcttattggcaaggataggc
gagtcggataaagtcttacagtttaatggtcattatgatgtagtatttcctggggaaggc
tggaaaatcacggatccatttaagcccctcaagaaaaatggtagaatctatggacgtgga
tctacagatatgaagggaggcatagcagccttcctagcagcaatgatatacttagcaacc
accaaggaggagccgcctataagtgttgaagcagcaattgttcctgacgaagaaataggc
ggagccactggaacagggtatttagttaatgtattgggtagtaagcctacctgggcagtc
atagctgagcccagcggcttagataacatatggcatggacataaaggacttgtatgggga
gaaatagttgttaagggtaaacagagccatggctccactccttggctaggaataaatgct
ttcgagaaaatggtttatgttgcaaaatacttgatagaaaattatctaccaagattaaag
gataaaacaagcaggtacgaatatgacttgcccgaaggcaaacacccgactgcgacgctt
ggaggaaaactatcagctccaggaagcataaatatagtgcctggacaagtatcattcagt
attgatcgcagactaataatagaggaaaatacaaatgatgcaattgaagaacttaacaaa
tacattgtggaagcagcaaagaaatatagtgccgatgttgaacttagaataattgagaga
atggagccagccttcaccgatcccagctctgaaatagttgaagcacttgcaaaagctata
cgaatggatacaggtgtggagcctaggaggacaatatgtgtcggaggactggatctaagg
tattactcgtataaggggataccggtagcaacttatggccctggagaaccgagtatgcct
cataaagttgatgaatacatagaagttgaaaacttgcataaggtaatagatgtgtacgta
gacctagttaatatacttggaagaagctcgtaa

DBGET integrated database retrieval system