KEGG   Staphylothermus hellenicus: Shell_0734Help
Entry
Shell_0734        CDS       T01249                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
shc  Staphylothermus hellenicus
Pathway
shc00260  Glycine, serine and threonine metabolism
shc01100  Metabolic pathways
shc01110  Biosynthesis of secondary metabolites
shc01120  Microbial metabolism in diverse environments
shc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:shc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Shell_0734
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Shell_0734
Enzymes [BR:shc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Shell_0734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADI31853
JGI: Shell_0734
UniProt: D7DCF6
Position
701460..702731
Genome map
AA seq 423 aa AA seqDB search
MFVKDLRCSKCGRIYSLEEKPVMCINKDLGRLDIRYDYEAIKNAVKPEDLAKREFHMWRY
REFLPVPNGKYIVSLGEGGTPLIKAGRLAEKLGLKKLYLKDETRNPTGSFKDRCMSVSVS
MAKYFGFKRAVVASSGNAAAALAAYGARAGIEVYAFVPDFAGYGKIAQLLFYGAKVFRVK
WVEAEDPTVKMMRLLAEKYGFYPSPSFGPFNPYQIEGPKTIAMEIVEQLGWNVPDQVFVP
TGAASLLTGVYNGFRDWNNVGWINKYPRMVAVQPEGNHPFVRAWMEKVDPDKIRPWEKPP
KTIATGLEDTFPWDGDAGLRALYNTNGYGVVVSDEEILEAMKLLASLEGLFAEPSGAAGL
AGLIKALEDGEVDRDETVVVLVTGHGLKDPDIVKKSAGDAPTINPDPQEFFVKAKEFYKV
DFN
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgttcgttaaggatctgagatgtagtaagtgtggtagaatatatagtttagaagagaag
ccggtaatgtgtataaacaaggatcttggtagactcgatatacgctacgactatgaagca
ataaaaaacgctgttaaaccagaagacttggcgaaaagagaatttcatatgtggagatac
agggaattcttgcctgtgcctaacgggaaatatattgttagcttaggcgaggggggaacg
cctctaataaaagctggtagacttgccgaaaagcttggattaaagaagctatacttgaag
gatgaaacacgcaatcctaccggtagctttaaggatagatgtatgagtgtctcagtatct
atggctaagtatttcgggtttaagagagcagtggttgccagcagcggtaatgctgcagct
gcattggctgcttacggggctagagcaggtatcgaagtatatgctttcgttcccgacttc
gcagggtatggtaagatcgcccagttattattctatggtgcaaaagttttcagggttaaa
tgggttgaagcagaggatccaacagttaagatgatgagattattagcggagaaatacggt
ttctatccatcaccaagtttcggaccatttaatccataccagattgaaggcccaaaaact
atagctatggagatcgttgagcaattagggtggaatgttcctgaccaagtattcgtgcca
accggtgccgcaagcttattgacaggagtctataatggttttcgtgactggaacaatgtg
ggatggataaataagtatcctagaatggttgctgtacagcctgagggtaatcatccattt
gttagagcgtggatggaaaaagttgatccagataagataaggccttgggagaaacctcca
aaaaccattgctacaggtctcgaagatacttttccatgggatggagatgcagggttaaga
gcactatataatactaatggttatggagtagtagttagtgatgaagaaatactggaggct
atgaagcttttagctagcttagaaggattgttcgcagaaccaagcggtgcagcgggtctt
gcaggattaattaaggcattagaggatggagaagtggatagagatgaaacagtagttgtg
cttgtaacaggtcatggtttaaaggatccagatattgtcaagaagtctgctggagatgca
ccaactataaatcctgatccacaagaattctttgtaaaagctaaagaattctataaagtt
gatttcaactag

DBGET integrated database retrieval system