KEGG   Staphylothermus hellenicus: Shell_0734Help
Entry
Shell_0734        CDS       T01249                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
shc  Staphylothermus hellenicus
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:shc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Shell_0734
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Shell_0734
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Shell_0734
Enzymes [BR:shc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Shell_0734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
701460..702731
Genome map
AA seq 423 aa AA seqDB search
MFVKDLRCSKCGRIYSLEEKPVMCINKDLGRLDIRYDYEAIKNAVKPEDLAKREFHMWRY
REFLPVPNGKYIVSLGEGGTPLIKAGRLAEKLGLKKLYLKDETRNPTGSFKDRCMSVSVS
MAKYFGFKRAVVASSGNAAAALAAYGARAGIEVYAFVPDFAGYGKIAQLLFYGAKVFRVK
WVEAEDPTVKMMRLLAEKYGFYPSPSFGPFNPYQIEGPKTIAMEIVEQLGWNVPDQVFVP
TGAASLLTGVYNGFRDWNNVGWINKYPRMVAVQPEGNHPFVRAWMEKVDPDKIRPWEKPP
KTIATGLEDTFPWDGDAGLRALYNTNGYGVVVSDEEILEAMKLLASLEGLFAEPSGAAGL
AGLIKALEDGEVDRDETVVVLVTGHGLKDPDIVKKSAGDAPTINPDPQEFFVKAKEFYKV
DFN
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgttcgttaaggatctgagatgtagtaagtgtggtagaatatatagtttagaagagaag
ccggtaatgtgtataaacaaggatcttggtagactcgatatacgctacgactatgaagca
ataaaaaacgctgttaaaccagaagacttggcgaaaagagaatttcatatgtggagatac
agggaattcttgcctgtgcctaacgggaaatatattgttagcttaggcgaggggggaacg
cctctaataaaagctggtagacttgccgaaaagcttggattaaagaagctatacttgaag
gatgaaacacgcaatcctaccggtagctttaaggatagatgtatgagtgtctcagtatct
atggctaagtatttcgggtttaagagagcagtggttgccagcagcggtaatgctgcagct
gcattggctgcttacggggctagagcaggtatcgaagtatatgctttcgttcccgacttc
gcagggtatggtaagatcgcccagttattattctatggtgcaaaagttttcagggttaaa
tgggttgaagcagaggatccaacagttaagatgatgagattattagcggagaaatacggt
ttctatccatcaccaagtttcggaccatttaatccataccagattgaaggcccaaaaact
atagctatggagatcgttgagcaattagggtggaatgttcctgaccaagtattcgtgcca
accggtgccgcaagcttattgacaggagtctataatggttttcgtgactggaacaatgtg
ggatggataaataagtatcctagaatggttgctgtacagcctgagggtaatcatccattt
gttagagcgtggatggaaaaagttgatccagataagataaggccttgggagaaacctcca
aaaaccattgctacaggtctcgaagatacttttccatgggatggagatgcagggttaaga
gcactatataatactaatggttatggagtagtagttagtgatgaagaaatactggaggct
atgaagcttttagctagcttagaaggattgttcgcagaaccaagcggtgcagcgggtctt
gcaggattaattaaggcattagaggatggagaagtggatagagatgaaacagtagttgtg
cttgtaacaggtcatggtttaaaggatccagatattgtcaagaagtctgctggagatgca
ccaactataaatcctgatccacaagaattctttgtaaaagctaaagaattctataaagtt
gatttcaactag

DBGET integrated database retrieval system