KEGG   Staphylothermus hellenicus: Shell_0759Help
Entry
Shell_0759        CDS       T01249                                 

Definition
(GenBank) Cellulase
Organism
shc  Staphylothermus hellenicus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
729941..731035
Genome map
AA seq 364 aa AA seqDB search
MNKNELYETLEKLTSIVSPSGHEDEIRNTIIELLKPYADELWVDSLGNIIAVKKGSSEGR
LMIAAHMDEIGLMINHITKTGFLKFTPIGGWNSVILPGQRVLIKTKRGEYVRGVIGMKPP
HIMKPEEAKQAPQIGDLFIDIGASSREEVGKLGVTIGSVAVIERSIAKLSGDVVTGRAFD
DKVGVAVLIEAFKNLEKPKVDVYAVATVMEEVGLKGARVAAYSITPYVGLALDVTIAADV
PGVDESKQITKLGKGPAIKVMDGRSGSGLIAHPAIKNTLIQLAEQHNIPYQLEVLTGGTT
DATIIQLTKEGVPTGALSIPTRYIHSPVEVLNLEDALNTAKLTKLFAEHIDIEWINKYLK
RKIK
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaataagaatgaattatatgagaccctcgaaaaacttactagtatagtttcgccttca
ggccatgaagatgaaattagaaatactattatagaattgcttaaaccatatgctgatgaa
ttatgggttgattcactgggaaacataatagctgttaagaagggaagcagtgaaggcagg
ttaatgattgctgctcacatggacgagatcggtttaatgataaatcatataacaaagact
ggattcctcaagtttacacctataggtgggtggaactctgttatattgcctgggcaaaga
gtccttataaaaactaagagaggagaatatgttcgtggagtaataggtatgaagccccca
cacattatgaagccagaggaagctaagcaggctccacaaataggtgacttatttatcgat
ataggcgcttctagcagggaggaagtggggaaactaggtgtaactattggatcagtagct
gtgatcgagagaagcattgctaagctttccggagatgttgtaactggtagagcatttgat
gacaaggttggtgtagcggtattgattgaagctttcaagaaccttgaaaaacccaaagta
gacgtgtatgctgtagcaactgttatggaggaagttgggttaaaaggagctagagtagca
gcgtactctataacaccatatgttggattagcactagacgtaaccatagcagctgatgta
cccggagttgatgaatcaaaacaaataaccaagctaggtaaagggcctgcaataaaagtt
atggatggaagatccggttcgggattaatagctcacccagcaatcaaaaatactctaata
caattagctgaacaacacaatattccataccaattagaagtattaaccggtggaacaacc
gatgcgacaataatacagttaacaaaggaaggtgttccaacaggtgcattatcaattcca
acaagatatattcattcacctgtagaagtattgaatctggaggatgcattaaatactgca
aaattgacaaaattgtttgctgaacatatagatattgaatggatcaataaatacttgaag
agaaaaataaagtag

DBGET integrated database retrieval system