KEGG   Staphylothermus hellenicus: Shell_0759Help
Entry
Shell_0759        CDS       T01249                                 

Definition
Cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
shc  Staphylothermus hellenicus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Shell_0759
Enzymes [BR:shc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Shell_0759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
729941..731035
Genome map
AA seq 364 aa AA seqDB search
MNKNELYETLEKLTSIVSPSGHEDEIRNTIIELLKPYADELWVDSLGNIIAVKKGSSEGR
LMIAAHMDEIGLMINHITKTGFLKFTPIGGWNSVILPGQRVLIKTKRGEYVRGVIGMKPP
HIMKPEEAKQAPQIGDLFIDIGASSREEVGKLGVTIGSVAVIERSIAKLSGDVVTGRAFD
DKVGVAVLIEAFKNLEKPKVDVYAVATVMEEVGLKGARVAAYSITPYVGLALDVTIAADV
PGVDESKQITKLGKGPAIKVMDGRSGSGLIAHPAIKNTLIQLAEQHNIPYQLEVLTGGTT
DATIIQLTKEGVPTGALSIPTRYIHSPVEVLNLEDALNTAKLTKLFAEHIDIEWINKYLK
RKIK
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaataagaatgaattatatgagaccctcgaaaaacttactagtatagtttcgccttca
ggccatgaagatgaaattagaaatactattatagaattgcttaaaccatatgctgatgaa
ttatgggttgattcactgggaaacataatagctgttaagaagggaagcagtgaaggcagg
ttaatgattgctgctcacatggacgagatcggtttaatgataaatcatataacaaagact
ggattcctcaagtttacacctataggtgggtggaactctgttatattgcctgggcaaaga
gtccttataaaaactaagagaggagaatatgttcgtggagtaataggtatgaagccccca
cacattatgaagccagaggaagctaagcaggctccacaaataggtgacttatttatcgat
ataggcgcttctagcagggaggaagtggggaaactaggtgtaactattggatcagtagct
gtgatcgagagaagcattgctaagctttccggagatgttgtaactggtagagcatttgat
gacaaggttggtgtagcggtattgattgaagctttcaagaaccttgaaaaacccaaagta
gacgtgtatgctgtagcaactgttatggaggaagttgggttaaaaggagctagagtagca
gcgtactctataacaccatatgttggattagcactagacgtaaccatagcagctgatgta
cccggagttgatgaatcaaaacaaataaccaagctaggtaaagggcctgcaataaaagtt
atggatggaagatccggttcgggattaatagctcacccagcaatcaaaaatactctaata
caattagctgaacaacacaatattccataccaattagaagtattaaccggtggaacaacc
gatgcgacaataatacagttaacaaaggaaggtgttccaacaggtgcattatcaattcca
acaagatatattcattcacctgtagaagtattgaatctggaggatgcattaaatactgca
aaattgacaaaattgtttgctgaacatatagatattgaatggatcaataaatacttgaag
agaaaaataaagtag

DBGET integrated database retrieval system