KEGG   Staphylothermus hellenicus: Shell_0794Help
Entry
Shell_0794        CDS       T01249                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
shc  Staphylothermus hellenicus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:shc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Shell_0794
Enzymes [BR:shc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Shell_0794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
762045..762983
Genome map
AA seq 312 aa AA seqDB search
MSAGEYEKYDVVAVGHALVDIRFIVDRFVGPDEEASIIKQTRGVGGSAANVSIDVSRLGG
RSAAIIKVGLDGFGRLVIDELMREKVDVSGVKVCLGDTGFTVVIIDRAGRIIMYGYKGSA
EKLEPKDLDEGIISRGKFLHIASLRLDTSLEAAKLAKKHGLKTAWDPGRRLSLKGLSYFD
ELLKYIDIALVNEKEAHHLTGISDYREAAKKILETGVWLVVVKRGPKGIYAVTSDGETYD
LPAFPVDKVIDTTGAGDAFASGLLLGLSRGYNLKKSLIYGNAVAALKTSRLGSHNVPSHE
EVIKYIWEHGLS
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
ttgagtgctggggaatacgaaaaatatgatgtggtagctgttggtcatgcattggttgat
ataaggtttattgttgataggtttgttggtcccgatgaggaagctagtattattaagcag
acacgtggcgtaggtgggtcggccgcgaatgtttctattgatgtatcaaggcttggaggt
agatcggctgccattattaaggttggattagatgggttcggcaggcttgttatcgatgag
cttatgcgtgagaaagtagatgtttcaggtgtaaaagtttgtcttggagatacaggtttt
acagtagtaatcattgatagggctggaagaataataatgtatggatacaaaggctcagca
gagaaacttgaacctaaagatcttgatgaaggaattatttcacgcggcaaattcctacat
attgcaagcttaagactagatacttcactagaagccgcgaagctggcgaagaagcatggt
ttaaaaactgcatgggacccgggtaggcgtttatccctgaagggattaagctactttgat
gaattattgaaatatatagatatagcattggtgaatgagaaagaagctcatcatttaacg
ggtattagtgattatagggaagccgctaagaaaatactggaaacaggtgtatggcttgtg
gtagttaagcggggacctaaaggtatatatgctgttacaagtgatggtgaaacatatgat
ctcccagctttcccagtagataaggtaatagatacaactggagccggagacgccttcgct
tccggattattacttggtttgagtagagggtataatttaaagaaatccctaatatatggg
aatgctgtagcagcattgaaaaccagtcgtttaggaagccataatgttccgagccatgaa
gaagtaataaaatatatatgggaacatggattatcctaa

DBGET integrated database retrieval system