KEGG   Staphylothermus hellenicus: Shell_0804Help
Entry
Shell_0804        CDS       T01249                                 

Definition
glycoside hydrolase family 1
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
shc  Staphylothermus hellenicus
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Shell_0804
  Lipid metabolism
   00600 Sphingolipid metabolism
    Shell_0804
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Shell_0804
Enzymes [BR:shc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Shell_0804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(772807..774372)
Genome map
AA seq 521 aa AA seqDB search
MGGSFTSSEKIEFPQGFKWGVSQSGFQFEMGDAYRRFIDTNTDWWHWVRDPYNISARLVS
GDLPEDGINYAELYRRDHEIAYRLGLNTYRIGIEWSRIFPHPTWFVEVDVEYDGNGLIKS
VKITEDTLRELDKLASQSALRFYRDIITDLRRLGFKVIVNLYHFTIPYWLHNPLRARETG
LRKGPLGLLEHSFPVEFAKYAAYMAWKLSDIVDFWSTINEPMVPAELGYLWPQSGFPPGV
NAPQSFPKAVTNLILAHSLAYDMVKKFDTVKADQDSDKAAHVGIIYNIVPVYGLSEGDEE
AAEHHSYLHNDAFLTAITSGKLDLNLDQTTIVKPPLLGGRKLDWIGVNYYTRAVVKRLEP
MHGNKIMDFATVPGYGYACNPYGFSKIGRWCSAMGWEHYPEGLEKAVLIARKYCENIYIT
ENGISDPHDIYRPAYIVNHVYVLHKLIENGVSVKGYLHWALLDNYEWAHGFRQRFGLYEV
DLTTKERKPRPSAMIYKSIAESNSIPKEYLKYLIEMKWDRA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgggaggatcttttacgtcttctgagaagatagagtttcctcaggggttcaaatggggt
gtttcgcagtctggatttcaatttgaaatgggggatgcttatagaaggtttattgatacc
aatactgattggtggcactgggttagggatccttacaatattagtgctaggcttgttagt
ggagacctacctgaggatgggataaattatgctgagctgtataggagggatcacgaaata
gcgtataggcttggcttaaacacttataggattgggatcgagtggagcagaatctttccc
cacccaacgtggtttgttgaggtggatgttgagtatgatggtaatggtcttataaaaagt
gttaagattaccgaggatactttgagggagctggacaaactagctagtcagagcgctcta
agattttatcgtgatataataacggatcttcgacgactaggctttaaagtaatagttaac
ctttaccatttcactataccctactggctccacaaccccctgagagctagagagacaggt
cttcgaaagggccccctaggattattagagcactccttcccagtagaattcgcaaaatat
gctgcgtatatggcgtggaagctgagtgatatagttgatttctggtcaaccataaacgag
cccatggtaccagcagaactgggctacctatggcctcaaagcggcttcccgccaggagtg
aatgccccccaatccttcccaaaggctgtaacaaatcttattctagcacactccctagca
tatgatatggttaagaaatttgacactgtaaaggcagatcaggactcggataaggctgct
catgtaggcataatatataatattgtcccagtgtatggtctcagcgagggagatgaagag
gctgcagaacatcactcctacctgcataacgatgctttcctaacagccattactagtggg
aaactcgatctaaaccttgaccagacaacaatcgttaagccgccgctattaggcgggagg
aaattagactggattggtgtaaactattatacaagagcagtggttaagcgtttagaaccc
atgcatggaaataaaatcatggacttcgccaccgtacctggctacggatacgcctgcaac
ccctacgggttctcaaagattgggagatggtgtagtgcaatgggatgggaacattatccc
gaggggttggagaaggctgtattgatagctaggaagtattgtgaaaacatatatattacc
gagaacggtatctcagacccccacgatatatatcgtccagcatacatagtaaaccatgta
tatgtcctacacaaactaatagagaacggtgtaagtgttaaaggatacctgcattgggct
ctattagacaactatgaatgggcacacggatttaggcaaagattcggattatacgaggta
gatcttactacaaaggagagaaaacccagaccctcagccatgatctacaaatccatagca
gaatcaaactctatacccaaagaatacttgaaatacctaatagaaatgaaatgggataga
gcctag

DBGET integrated database retrieval system