KEGG   Staphylothermus hellenicus: Shell_0821Help
Entry
Shell_0821        CDS       T01249                                 

Definition
aldehyde ferredoxin oxidoreductase
Orthology
K11389  
glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
shc  Staphylothermus hellenicus
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:shc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Shell_0821
   01230 Biosynthesis of amino acids
    Shell_0821
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shell_0821
Enzymes [BR:shc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.6  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin)
     Shell_0821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(793464..795440)
Genome map
AA seq 658 aa AA seqDB search
MSGSSTTYRVLFIDVSNRKYWVEEHGLEEVIGPIELGVKLHLEKYKSWKKPAYSPDNAVV
IGAGIFTGTNLYGGHRFVAVFKSPITRGLHVAAMGGAAYQFNVNADAIVVEGRSNKPLII
KVYDEGDGEVKADFDEIDEKELENIWRNYKGEKGIYAFQEYLSEKYKKFYEEYNGRSILV
GPASKHTSLGALASITLVKGRIDWGSEDLAARGGPGSVLYRAHGVAAIVYGGKFDRRTKR
PKDLLDTRKINELFREIAGKPYITMVIEAGTKYRYNPKLNTGGTLGGNYPSLKIHTPMFN
WNMIYLPPDLREKLHELIMKHIWEPFNKEAIETKSWKTCGEPCPIACKKVRLDRYKSDYE
PYEGFGPFIGVFDIHESQKIVELVDAYGFDTIETGQLVGFIYDALEKGLLTPGEVGLPSK
PFFNPYDFKYEYSKHNAELAVQLIENLAWGKNPLLKLIGEKGLRSAAKILDILYENRVRE
RKWRFSDLLVYASFGEEGHITPNYYWTPGMVAPLPVLGRYWTLYKGVFLDPEQYAEKSFE
RAIKEMWSDNGGFCRFHRKWAEKTLDKLYEKYYGIKNLDERYKQLYRKIMEYQDLAGAKP
TFWESKKIIDYLANAAKEYGNDEWNTKFSLNKEKAAREWWERFYAKLNKLLSSTSLEK
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
ttgagtggttcttcaacaacgtatagggtattatttatagatgttagcaataggaaatac
tgggtagaagaacacggtctagaagaagtaatcgggcctattgagcttggagtaaagctt
cacctcgaaaaatataagtcttggaaaaaacccgcatatagtcctgataatgctgttgta
attggtgcgggtatctttactgggacaaacctttacggtggccacaggtttgtagctgta
ttcaagagccctatcacgagaggattacatgttgctgcaatgggtggtgctgcttatcaa
tttaacgtgaatgctgacgcaatagttgtcgagggcagatccaataagcccttaatcatt
aaagtatatgatgaaggagatggagaagtcaaagcagattttgacgagatagacgagaaa
gaactagaaaatatttggagaaactataagggagaaaaaggcatatatgctttccaagaa
tatctaagcgagaaatataagaagttctacgaggaatataatgggagatcaatacttgtc
ggaccagcatccaagcatactagcctaggagcactagcatcaattactctagtaaaagga
agaattgattggggaagcgaagacctagctgcacgaggcggtcctggaagtgttctctac
agagcacatggtgtagcagctatagtgtatggtggaaaattcgatagaagaaccaagaga
ccaaaagatctcttagatacacgtaaaataaatgagttgttcagagaaatagctggaaaa
ccatatataacaatggttatcgaggctggaaccaagtatagatacaacccgaagctcaac
actggaggcacgcttggaggaaactatcccagcttaaaaatacatacgccaatgtttaac
tggaacatgatctatttaccgcctgatctcagagaaaaactacatgaactaataatgaaa
cacatatgggaaccattcaataaggaagcaatagagactaaatcatggaaaacatgtgga
gagccatgcccaatagcgtgtaagaaagttagactagacaggtataaatcagactatgaa
ccctacgaaggattcgggccattcattggagtatttgatatacacgagtcacagaagata
gtagaactggtagatgcatatggtttcgacactatagagacaggacaactagttggattc
atatatgatgctcttgagaagggattattaacgcctggagaagtagggttgccgagtaaa
ccattcttcaatccatacgatttcaaatatgaatacagtaaacacaatgctgaactagca
gttcaactaatagagaacttagcatggggtaagaacccattattgaagctgataggtgaa
aaaggattaagatcagctgctaaaatactggatatactgtatgagaacagagttagagag
aggaaatggaggttctcagacctactagtatatgcatccttcggcgaagaaggacacata
acacctaactattactggacacctggaatggttgcaccactaccagtattgggaagatac
tggacactctataaaggagtattcctagaccctgaacaatacgctgagaaaagctttgag
agagcaataaaggaaatgtggagcgataacggcggattctgcagattccatcgtaaatgg
gctgagaaaacacttgacaaactatacgagaaatactatggaataaagaacctagatgaa
agatacaagcaattatacaggaaaataatggaataccaagacctagcaggcgctaaacca
acattttgggaatccaagaaaataatagactatctagctaatgcagccaaagaatacggc
aacgatgaatggaacactaaattctccctgaacaaggagaaagcggctagagaatggtgg
gagagattctatgctaaactaaacaagttattatcaagtacgtcgctggagaaatag

DBGET integrated database retrieval system