KEGG   Staphylothermus hellenicus: Shell_0833Help
Entry
Shell_0833        CDS       T01249                                 

Definition
histone acetyltransferase, ELP3 family (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
shc  Staphylothermus hellenicus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
810585..812081
Genome map
AA seq 498 aa AA seqDB search
MFKTQYFFLEKHVWRKILSSVKARLGKIRKPSRMLSGVSVVAVMTHPIPCPFNCYYCPGG
PEYNAPKSYFGNEPALRRARRNQFHPYKQVWNRLLQYEYLKQVPSKVEIIVMGGTFLAAR
QRYKEWFITMIFEALNRYPDPNPPRKWDLESAQLRNETANHRCVGLTIETRPDYGYEKHA
DEMLYYGATRVELGVQSIYDDVLLRVNRGHGVAESIKSTRILKDAGFKIVYHIMLGLPGS
DPDRDIEMMKEIFENPDFRPDMLKIYPTEVVEGTVLYQWWREGRYKPYDDETAIEVISEM
YRYIPKYVRVMRIRRDIPAPEVVAGTKKSNLREYVEKRCMEKGIKINEIRFREVGLQAWK
YGRIPDPKHIEITRTTYEASGGIEEFLAVEDTRNDIIIGFLRMRIPSEKAHRPEVDSRTA
IIRELHVYGPELPVGIHGESWQHKGWGAKLLKEAERIAVEEYDAKKMLVLSGIGVREYYR
KYGYYRPPNSPYMHKILS
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
ttgtttaaaacacaatattttttcttggaaaaacatgtgtggcgaaaaatcttgagcagc
gtcaaagcaagattgggaaagattaggaaaccctctaggatgcttagcggtgttagcgta
gttgctgttatgacgcatccaataccctgtccattcaactgttattattgtcctggagga
ccagaatataatgctccaaaaagctatttcggaaacgagccagctttgaggagagctcgt
agaaaccagtttcacccatataagcaggtttggaatagactgcttcaatacgagtatctc
aaacaagttcctagcaaggttgaaatcatagttatgggtgggactttcctagcggctcgg
cagaggtataaggaatggtttataacaatgatctttgaagcactcaacaggtatccggac
ccgaatcctcctaggaaatgggatctggagagtgcacagttgaggaatgagactgctaat
catagatgtgttggtttaacaattgagactaggcccgattatggatatgagaagcatgct
gatgaaatgctatactatggtgctacacgtgttgagctaggtgttcaaagcatctatgac
gatgtcttgttaagagttaatagggggcatggtgttgctgaatcaataaagtctactaga
atacttaaggatgcaggttttaaaatagtataccatataatgcttggattacccggcagc
gatcccgatagagatattgagatgatgaaggaaatatttgagaacccagattttagacca
gacatgctgaagatttatccaacagaagttgttgaaggaacagttctataccagtggtgg
agggagggcaggtataagccatacgatgatgaaacagctattgaggttatatcggagatg
tacaggtatataccgaaatatgttagagtaatgaggattagaagagacataccagcacca
gaagttgtagctggaactaagaagtctaatcttagagaatatgttgagaagagatgcatg
gagaaagggatcaagataaacgagatcaggtttagagaagtaggattacaagcttggaaa
tatggtagaatccctgatccaaaacatatagagataactaggacaacatatgaagcaagc
ggtgggatagaggagtttttagctgttgaagatacaagaaacgatatcataataggattc
ctacgcatgcgtataccaagcgagaaagcgcatagaccagaagtagatagtagaacagca
atcattagggaactacatgtttacggtccagaactaccagttggaatacatggagaatca
tggcagcacaaaggatggggagcaaaattgttgaaggaagcagagagaatagctgtcgaa
gaatatgatgctaagaaaatgcttgtcctatcaggaataggagttagagaatactatcgc
aaatacggatactatagaccaccaaatagcccatacatgcataaaatactttcctaa

DBGET integrated database retrieval system