KEGG   Staphylothermus hellenicus: Shell_0900Help
Entry
Shell_0900        CDS       T01249                                 

Definition
(RefSeq) dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
  KO
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
shc  Staphylothermus hellenicus
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:shc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Shell_0900
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Shell_0900
Enzymes [BR:shc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Shell_0900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
870005..870562
Genome map
AA seq 185 aa AA seqDB search
MPFEFRRMDIPDVVLIIPKVFEDERGFFMETYKKPDFERAGIRGNFVQDNHSRSRYGVLR
GLHFQREPYAQAKIVRCVRGVIYDVAVDLRRNSKTFGKYVGVILSEFNKYMLYIPRGFAH
GFLVLSEEAEVIYKVDNLYAPEYEAGLIWNDPDVGIKWPIEEPILSEKDKKWPTLRELVE
KNLVF
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
ttgccgtttgagtttaggagaatggatatcccggatgtggtgcttattatacctaaggtt
tttgaggatgagcgtggcttctttatggagacttataagaagcctgactttgagagggct
gggattaggggtaactttgtccaggataatcattctaggtctagatatggtgttttaagg
gggctacactttcagagggagccttatgctcaggctaagatagttaggtgtgtgagggga
gttatatatgatgttgccgtggatctgcgtaggaattcgaagacgtttggtaaatatgtt
ggtgtaattctgtcagagtttaataagtatatgctctatattccgagggggtttgcacat
ggattcctagtattgagtgaggaggctgaggtgatctataaggtagataacctatatgca
cctgaatatgaggctgggttaatatggaatgaccctgatgtaggtattaaatggcctata
gaagaacctatattatctgagaaggataagaagtggccgacgctacgagaactagttgag
aaaaaccttgtcttctag

DBGET integrated database retrieval system