KEGG   Staphylothermus hellenicus: Shell_0930Help
Entry
Shell_0930        CDS       T01249                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
shc  Staphylothermus hellenicus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:shc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Shell_0930
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shell_0930
   00052 Galactose metabolism
    Shell_0930
   00500 Starch and sucrose metabolism
    Shell_0930
   00520 Amino sugar and nucleotide sugar metabolism
    Shell_0930
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Shell_0930
   00524 Butirosin and neomycin biosynthesis
    Shell_0930
Enzymes [BR:shc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Shell_0930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(896901..897875)
Genome map
AA seq 324 aa AA seqDB search
MANEYYLAIDIGATNTRIAIGSRNGIIHKIIYRTPREGNELSIAVKIYEEIKKNYGKYID
QIKAVGIGTIGPLDLRRGRVVNTPNLPIHTFELRDPLMEWLKKPVYVLNDAVAGVWGEKF
FGLGRNYSNIAYITMSTGIGGGAIVNNHLLLGKNGNAHEIGHIVVKYDSDIKCGCGGYGH
WEAYAGGANIPRTARVLAEKHKPLIETEAYQEALRGELTPQKLFEYYRRNDLFAKYVVEE
IIDASAAGLATTINLYDPEVVTIGGSIYLYNQDILKEPIIRKALKHLVTEPPIIETTPLG
GDIVLYGALATAINPPEDILGFYK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
ttggcgaatgaatattatttagctattgatataggagcaacaaatactaggatagctatt
ggttctcggaatggaataatacataaaataatctataggactccgagggaagggaacgag
ctgagtattgctgttaaaatatatgaggagatcaagaagaattatgggaaatatattgat
caaattaaagctgtagggatcgggacaattggccccctggatttgaggaggggaagagtt
gtaaacacacctaatctacccatacatacctttgaactaagggatccattgatggaatgg
ttgaagaagcctgtatatgtattaaacgatgcagttgcaggtgtttggggagagaaattc
tttggtttaggcagaaattattccaacatagcatatataactatgagcacaggcattggt
ggtggagctattgttaacaatcacctcttgctagggaaaaacgggaatgcacatgagata
gggcatattgttgtaaaatatgattcagatattaaatgtggttgtggaggatacggtcat
tgggaagcatatgctgggggagcaaatattcccagaacagcccgggtcctagctgagaag
cataaaccattaattgagacagaagcgtatcaggaagcattgaggggagaactaactcct
caaaaactattcgaatactatagaagaaacgatttattcgcaaaatatgttgttgaagaa
ataattgatgcctcagcagcaggtctggctacaacgataaacctctacgatccagaagta
gtaactattggtggaagcatatatctatataatcaagacatactcaaagaacccattatt
aggaaagcacttaagcacttagtaactgagcccccgattatagagacaacgcctctcggc
ggagacatagtattatatggagctttagcaacagcaattaatcctccggaagacatatta
ggtttttataaataa

DBGET integrated database retrieval system