KEGG   Staphylothermus hellenicus: Shell_1001Help
Entry
Shell_1001        CDS       T01249                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
shc  Staphylothermus hellenicus
Pathway
shc00010  Glycolysis / Gluconeogenesis
shc00020  Citrate cycle (TCA cycle)
shc00620  Pyruvate metabolism
shc00640  Propanoate metabolism
shc00650  Butanoate metabolism
shc00680  Methane metabolism
shc00720  Carbon fixation pathways in prokaryotes
shc01100  Metabolic pathways
shc01120  Microbial metabolism in diverse environments
shc01130  Biosynthesis of antibiotics
shc01200  Carbon metabolism
Module
shc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:shc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shell_1001
   00020 Citrate cycle (TCA cycle)
    Shell_1001
   00620 Pyruvate metabolism
    Shell_1001
   00640 Propanoate metabolism
    Shell_1001
   00650 Butanoate metabolism
    Shell_1001
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Shell_1001
   00680 Methane metabolism
    Shell_1001
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Shell_1001
Enzymes [BR:shc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Shell_1001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_10 Fer4_9 Fer4_16 Fer4_7 Fer4_2 Fer4_17 Fer4_13 Fer4_4 Fer4_8 Fer4_15
Motif
Other DBs
NCBI-ProteinID: ADI32106
JGI: Shell_1001
UniProt: D7D8L0
Position
complement(961867..962157)
Genome map
AA seq 96 aa AA seqDB search
MTSTHKEPRGWKDLPLGAVSYRLSTDYKTGDWRALRPVVDLNKCVKCMLCWIFCPDMAIV
WDGEKIVINYDYCKGCGICAHECPVNAITMVPEPTE
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
ttgacttctacacataaagaaccccgtggctggaaagacctgcccttaggagctgtttcc
tacaggctttcaacagattataaaacaggagattggagagcgttaagaccggttgttgac
ttaaataaatgtgttaaatgcatgctgtgctggatattctgccccgacatggcgattgta
tgggatggagaaaaaatcgtgatcaactatgattactgtaaaggatgcggtatatgtgca
catgaatgcccagttaacgcgatcaccatggtccctgaaccgactgagtga

DBGET integrated database retrieval system