KEGG   Staphylothermus hellenicus: Shell_1002Help
Entry
Shell_1002        CDS       T01249                                 

Definition
pyruvate/ketoisovalerate oxidoreductase, subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
shc  Staphylothermus hellenicus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:shc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Shell_1002
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shell_1002
   00020 Citrate cycle (TCA cycle)
    Shell_1002
   00620 Pyruvate metabolism
    Shell_1002
   00640 Propanoate metabolism
    Shell_1002
   00650 Butanoate metabolism
    Shell_1002
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Shell_1002
   00680 Methane metabolism
    Shell_1002
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Shell_1002
Enzymes [BR:shc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Shell_1002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(962163..962738)
Genome map
AA seq 191 aa AA seqDB search
MMLVRYMLEIRWHGRGGQGAWTAANLLAMAAAYDGKHVQSFPAFGPERSGAPILAFTRIS
DEPIDLHSMVYEPDIVIVLDPTLLKNVNVVSGLKKNGLIIVNYEGDTDKLYNMLGIKKDE
YKVVVTPATKLALDILKRPITNTPMIGALIKAAPIVSFESIEKAVKKRFPGSIAEKNIAL
IKEAYKLAKEV
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgatgttggtgagatatatgcttgagattcgctggcatggtcgtggtggtcagggtgca
tggactgctgccaacttattagcaatggcggctgcatatgatggcaagcatgttcagagt
tttccagcattcggaccggaaagatcaggtgctcctatcctagcatttacacgtattagt
gatgaaccaattgatttacacagcatggtgtatgaacccgacatagtgatcgtactagat
ccgacattattgaagaatgtaaatgtagtgagtggtttaaaaaagaacggattaattatc
gttaactatgaaggcgacacagataaactctataatatgcttggtattaagaaagacgaa
tacaaagtagtggtaacacctgctacaaagctagcactagatattctcaagagacccata
acaaatactcccatgatcggagcattaataaaggctgcgccaatagttagttttgaaagc
atagaaaaagctgtgaaaaagagattccctggctccatagctgagaagaatattgcatta
ataaaagaagcttataagctggctaaggaggtgtaa

DBGET integrated database retrieval system