KEGG   Staphylothermus hellenicus: Shell_1165Help
Entry
Shell_1165        CDS       T01249                                 

Definition
(GenBank) Phosphoglucosamine mutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
shc  Staphylothermus hellenicus
Pathway
shc00010  Glycolysis / Gluconeogenesis
shc00030  Pentose phosphate pathway
shc00051  Fructose and mannose metabolism
shc00052  Galactose metabolism
shc00230  Purine metabolism
shc00500  Starch and sucrose metabolism
shc00520  Amino sugar and nucleotide sugar metabolism
shc00521  Streptomycin biosynthesis
shc01100  Metabolic pathways
shc01110  Biosynthesis of secondary metabolites
shc01120  Microbial metabolism in diverse environments
shc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:shc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shell_1165
   00030 Pentose phosphate pathway
    Shell_1165
   00051 Fructose and mannose metabolism
    Shell_1165
   00052 Galactose metabolism
    Shell_1165
   00500 Starch and sucrose metabolism
    Shell_1165
   00520 Amino sugar and nucleotide sugar metabolism
    Shell_1165
  Nucleotide metabolism
   00230 Purine metabolism
    Shell_1165
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Shell_1165
Enzymes [BR:shc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Shell_1165
    5.4.2.8  phosphomannomutase
     Shell_1165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV GTP_EFTU_D4
Motif
Other DBs
NCBI-ProteinID: ADI32265
JGI: Shell_1165
UniProt: D7D919
Position
complement(1128224..1129597)
Genome map
AA seq 457 aa AA seqDB search
MGRLFGTDGVRGIVNEELTPELGLKLGMAIGTFFGEGSKILVGRDVRAGGYMIKSAVIAG
LLSTGVKVYDGELAPTPALQYAVKTQDFDGGVIITASHNPSKYNGIKVVAADGIEVPREK
ELEIEEIYFSQRFRRVPWRQLLHDAKPYPYVNDIYVRGVIEKVDKDLIRSKGFKIVIDPA
NSVGALTSPRIARELGVKVYTVNGHLDPTFPGREPEPVPEHLGETARTVVSIGAVLGVAH
DGDADRAIFIDDKGRVQWGDRTATILARYLVEKHPELPRKVYTAVSSSTVIEEILKPLGI
EVVWLKVGSVDISRTMQRNNDALCGFEENGGFMYPPHQLVRDGGMTLALMLEMLAKENRK
LSEIYDELPQYHLIKTKIPMTRDKALLVVERVKEYFKNYRQITIDGVKVISDDFWLLVRP
SGTEPLLRIMLEAKTKDKAEELLSIVRKIAEEVAGKK
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgggtagattatttggtacagatggtgttagaggaattgtaaatgaggagttaacccca
gagcttggattaaagcttggaatggctataggcacattttttggagagggatcaaagatt
cttgtgggtagagatgttcgtgcaggcggatacatgataaaatcagctgttatagctggg
ttattgtctactggtgtaaaagtttatgatggagaactagctccaacacctgctctacaa
tatgctgttaagacacaggattttgatggtggagttataataactgctagtcataatccc
tctaaatataatgggatcaaagttgtagctgctgatggaatagaggttccgcgtgaaaaa
gagcttgagatcgaggagatatattttagtcagaggtttaggagggttccatggaggcaa
ttattacatgatgctaaaccttacccctatgtaaacgatatatatgttagaggagtaatt
gaaaaagtagataaggatctaatacgtagtaaggggttcaaaatagttatagatcccgct
aatagtgttggagcattaacatcgcctaggatagctagagaactcggagtcaaagtttac
acagtcaatggacatttagatcccacgtttccggggagagagcctgaacccgtacctgag
catctaggtgaaacagcgagaactgttgttagcattggcgcggttttaggagttgcacat
gatggagatgctgatcgagccatatttattgatgataagggtagggtgcaatggggtgat
cgcacagcaacgattcttgccaggtatctcgttgaaaaacatcctgaactacctagaaaa
gtatatacagcagtttcatccagcactgttatcgaagaaatactgaaaccactcggcata
gaagtagtatggttaaaggttggaagtgttgatatttcgagaacaatgcagagaaacaat
gatgctctttgcggattcgaggagaacggtggattcatgtatccaccgcatcaactagtt
agggatggaggcatgactctagccctcatgctggaaatgcttgctaaagagaatagaaag
ctctcagaaatatatgatgagctcccacaatatcatttgataaaaacaaaaattccaatg
acaagagataaagcattacttgttgttgaacgagttaaagaatactttaagaactatagg
caaataacaattgacggtgtaaaagttatatctgatgacttttggttactggtaaggccc
agcggcacagagcctttgctgagaataatgttagaagcaaaaactaaggataaagcagaa
gaactattatcaatagttaggaaaatcgctgaagaggtggcagggaagaaatga

DBGET integrated database retrieval system