KEGG   Staphylothermus hellenicus: Shell_1302Help
Entry
Shell_1302        CDS       T01249                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
shc  Staphylothermus hellenicus
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:shc00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Shell_1302
Enzymes [BR:shc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Shell_1302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1251481..1252077)
Genome map
AA seq 198 aa AA seqDB search
MLIHSMKLLVSLGYTNPKGGNGSIRVDDRRILITPSGIPKHLLKTDDLVLYDIINNSYIG
KYKPSIEVNAHAKTYRVRNDIHAILHAHLPLATSLTDIGLENWWLAGTVEAEYSLGKVYV
SEYAPPGSLELAEKIAEGFRAGAKIVIVPRHGVFAGGKDVADALDSIIALESTAKYVYVK
VVVEELRNIKNKVLNGST
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcttattcactctatgaagctccttgtcagcctcggttatacaaatccgaaaggtgga
aatggaagtattagggttgatgatcgccgcatacttataactcccagcggtattcctaag
catttgctgaaaacagatgatctagtattatatgatattataaataattcatatattggt
aaatacaagccaagcatagaggttaatgcacatgcaaaaacatatagggttcgaaacgat
atccacgcaatactacatgctcacttaccattagctacatcattaacagatataggttta
gaaaactggtggcttgcaggcactgttgaggcagaatatagtcttggaaaagtatatgtt
tcagaatatgcgcctccaggctctctagagcttgcggaaaaaattgccgaaggttttagg
gctggtgcaaaaatagttattgttcccagacacggagtatttgctggcggtaaagatgtt
gcagatgctttggattccataatagctttggagtcgacggcgaaatacgtatatgtaaaa
gttgttgttgaggaattaaggaatataaagaataaagttttaaatgggtctacttag

DBGET integrated database retrieval system