KEGG   Staphylothermus hellenicus: Shell_1406Help
Entry
Shell_1406        CDS       T01249                                 

Definition
zinc-binding alcohol dehydrogenase family protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
shc  Staphylothermus hellenicus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:shc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Shell_1406
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shell_1406
  Lipid metabolism
   00071 Fatty acid degradation
    Shell_1406
  Amino acid metabolism
   00350 Tyrosine metabolism
    Shell_1406
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Shell_1406
   00626 Naphthalene degradation
    Shell_1406
Enzymes [BR:shc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Shell_1406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1355542..1356546
Genome map
AA seq 334 aa AA seqDB search
MKAMVLYEPGPVEKNPLKLSDVDIRDPRGDEVLLEISCCGVCRTDLHIVEGELKPIKLPL
IPGHQVVARVKEVGENVDNVSKGMRVGVPWLYWACGKCKYCRRGLENLCDHALFTGYSVD
GGYAEYMIAKKDFVHPLPNTHDDCKAAPLLCAGAVGYRALRLTGLVDKKEGILGLFGFGA
SAHLILQAAKALGLTVYVFTHTPWKIEYAYKLGADWAGNTKETPPNKLDAAIVFAPVSWV
FIEALKKLDKGGRVVLGEIYMSPIEKLDYKLLWLEREVKTTANVTRRDVREFLDIASKHR
IYPDITIYKLEEANKALQDLKHGKIKGQAVLKIK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagccatggttctatatgaacctggacctgtagagaaaaatccgttaaaacttagc
gatgttgatataagggatccacgcggagacgaggtattattagagatatcatgttgtgga
gtttgtagaacagatctacatatagttgagggagaactcaaaccaatcaaactccctctt
atacctggtcaccaagtagtagctcgagtaaaagaggttggggaaaatgttgataatgta
agtaaaggtatgagggtaggagttccctggctttactgggcatgtggaaaatgcaagtat
tgtaggaggggattagaaaacctatgtgatcacgcattattcactggatatagtgttgat
ggaggatatgctgaatacatgattgctaagaaggacttcgtgcacccactcccaaacact
catgacgactgcaaagccgctcctctactatgtgctggcgctgttgggtatagagcccta
cgcttaacagggctagtcgataagaaagaaggcatactgggcttattcggattcggcgca
tcagcacatctaattctacaagctgcaaaagcacttggtttaactgtgtatgttttcaca
catactccatggaagatagagtacgcatataagctcggtgcagattgggctggaaacaca
aaggaaacaccgcctaataaactggatgcagcaatagtgttcgcacctgtatcatgggtc
tttatcgaagcattgaaaaaacttgataagggcggaagagttgttctaggagaaatatat
atgtcgcctattgagaaacttgactataaactactatggctggagagagaagtaaaaaca
acagctaacgttacacgtagagatgtccgggaatttctagatatagcatcaaagcacaga
atataccctgatataacgatttataaattagaagaagccaataaggcgttacaagacctt
aaacatggaaagatcaagggccaagctgttttgaaaataaaataa

DBGET integrated database retrieval system