KEGG   Staphylothermus hellenicus: Shell_1461Help
Entry
Shell_1461        CDS       T01249                                 

Definition
pyruvate/ketoisovalerate oxidoreductase, subunit gamma (EC:1.2.7.1)
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
shc  Staphylothermus hellenicus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:shc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Shell_1461
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shell_1461
   00020 Citrate cycle (TCA cycle)
    Shell_1461
   00620 Pyruvate metabolism
    Shell_1461
   00640 Propanoate metabolism
    Shell_1461
   00650 Butanoate metabolism
    Shell_1461
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Shell_1461
   00680 Methane metabolism
    Shell_1461
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Shell_1461
Enzymes [BR:shc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Shell_1461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1398912..1399523
Genome map
AA seq 203 aa AA seqDB search
MLVGADELMMYEIIFYGRGGQGGVTAANILVHAALYQKLYGQGFPFFGAERRGAPVMAFA
RISDKPIVRHGMFYEADILVILDHKLIDIGATKKVYVRDNGYVIVNMPSDYEIDYGKFNI
LGKARFYGVNAKKIALENKLVVAGWPVVNTSMLGALSKATKIISVENIMKAIKSYFGGRV
GEANAKAAFQAYNETPLIREVNM
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
ttgctggttggagcggatgagctaatgatgtatgaaataatattttatggtagaggcggt
cagggaggagtgaccgctgctaatatacttgttcatgcagcactatatcagaaactatat
ggacaaggcttcccattcttcggcgctgaaaggagaggggctcctgttatggcatttgct
aggatcagtgataaaccaatagttagacatggaatgttctatgaagcagatattctagta
atactagatcataaactaatagatattggagcgacaaagaaagtctatgtaagagataat
ggatatgtaatcgtaaatatgccgagtgattatgaaattgattatggaaaattcaatatt
ttaggtaaagcgagattctatggtgttaacgctaagaaaatagctttagaaaataagcta
gttgttgcaggatggcccgtagtaaatacttcaatgcttggagcattatctaaagctaca
aagataataagtgttgaaaacataatgaaagcaataaaatcctattttggaggaagagtt
ggggaagctaatgctaaagcagcttttcaagcctataatgaaactcccttgataagagag
gtgaatatgtaa

DBGET integrated database retrieval system