KEGG   Staphylothermus hellenicus: Shell_1463Help
Entry
Shell_1463        CDS       T01249                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
shc  Staphylothermus hellenicus
Pathway
shc00010  Glycolysis / Gluconeogenesis
shc00020  Citrate cycle (TCA cycle)
shc00620  Pyruvate metabolism
shc00640  Propanoate metabolism
shc00650  Butanoate metabolism
shc00680  Methane metabolism
shc00720  Carbon fixation pathways in prokaryotes
shc01100  Metabolic pathways
shc01120  Microbial metabolism in diverse environments
shc01130  Biosynthesis of antibiotics
shc01200  Carbon metabolism
Module
shc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:shc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shell_1463
   00020 Citrate cycle (TCA cycle)
    Shell_1463
   00620 Pyruvate metabolism
    Shell_1463
   00640 Propanoate metabolism
    Shell_1463
   00650 Butanoate metabolism
    Shell_1463
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Shell_1463
   00680 Methane metabolism
    Shell_1463
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Shell_1463
Enzymes [BR:shc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Shell_1463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C
Motif
Other DBs
NCBI-ProteinID: ADI32551
JGI: Shell_1463
UniProt: D7D9V5
Position
1399819..1400997
Genome map
AA seq 392 aa AA seqDB search
MGKLVALTGNYSVAYAAKYARIDVVAAYPITPQTSIVEKLAELIESGELDATMIRVESEH
SALAATFGAAVAGARAFTATSSQGLMYMHEWVHWTARARIPVVMAIVTRALAPPWNIWPD
HTDFMDQRDTGWIMSFGMDNQEVFDLTLQAFKISEDPRVYLPVMVGLEGFILGHTTMPVE
LPDQKDVDDWLGPRKQGYVVDGKEPIAIGNLAWPEDTEEMLMDIQKAMNEAKNVIKEVDQ
EYGKIFGRSYGGLIQCINCEDAKYYAVSMGAWSGDLIEAVNMLREEGYPIGVLRIRYYRP
FPYEDIWEKIRGAKGVIVFDRAISFGAWGQIFTDLITGLTMYTRNLPVISNIVAGIGGVN
VTYTEFYNLVKEFIEKIEKGEEPPLFKWYHRR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaactcgtagctttaacaggtaattattctgttgcatacgcagccaagtatgca
cgaatagatgttgtcgcagcatatcctattacaccacaaacaagcatcgttgagaaactc
gcggaactaatagagtctggagaactagatgctacaatgatccgtgttgaaagcgaacat
tcagcattagccgcaacttttggagctgcagtagctggtgcccgcgcatttacggcgaca
agtagccagggactcatgtatatgcatgaatgggtgcattggactgctcgagcaagaatt
ccagtagttatggctatagtaactagggctctagctcctccgtggaatatttggcctgat
cacacggacttcatggatcaacgtgatacaggatggattatgagttttggaatggataat
caagaagtattcgacttaacactacaagcatttaagatcagcgaagatcctagagtatat
ctgccagtcatggttggattggaaggatttattctaggacatacaactatgcctgtcgaa
ctacccgatcagaaggatgtagatgattggctgggcccacgtaaacaaggctatgtagtc
gatggtaaagagcccattgctattggtaatctcgcatggcctgaagatacagaggaaatg
cttatggatatacagaaagctatgaacgaagctaaaaacgttataaaagaagtagatcag
gagtatgggaaaatctttggtagaagctatggcggcttaatacaatgtattaattgtgaa
gacgccaaatactatgctgtatccatgggtgcgtggagcggggatcttatagaagctgtt
aatatgctacgtgaagaaggatatcctataggagtattaagaataagatactataggcca
ttcccatacgaggatatatgggagaaaattagaggtgctaaaggagtaattgttttcgat
agagcaataagctttggtgcttggggacaaatattcaccgacttaattactggtttaacc
atgtatactagaaatcttccagtgatatcgaatattgtagctggcataggaggcgtcaat
gtaacatatactgaattctataacttagtcaaagaattcatagaaaaaattgagaaggga
gaagaacccccgcttttcaaatggtatcataggaggtga

DBGET integrated database retrieval system