KEGG   Staphylothermus hellenicus: Shell_1565Help
Entry
Shell_1565        CDS       T01249                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
shc  Staphylothermus hellenicus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:shc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Shell_1565
   01230 Biosynthesis of amino acids
    Shell_1565
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shell_1565
   00030 Pentose phosphate pathway
    Shell_1565
   00051 Fructose and mannose metabolism
    Shell_1565
  Energy metabolism
   00680 Methane metabolism
    Shell_1565
Enzymes [BR:shc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Shell_1565
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Shell_1565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1493010..1494182
Genome map
AA seq 390 aa AA seqDB search
MSEGEKITLSVIKADVGSISGHVMPHPDQLAAATKVLAEAKQKGLLIDFHVTHVGDDIQL
IMTHRKGVDAPEIHELAWNAFKAAAKVARELKLYAAGQDLLSDAFSGNVRGLGPGVAEIE
MVERKAEPVITFHADKTEPGAFNLPIFRIFADPFNTAGLVIDPRMHDGFIFEVYDVFEGK
SVKLSAPEEMYDILALIGTPGRYVVRRVYRKSDNLQAAVVSVERLNLIAGKYVGKDDPVA
IVRAQHGLPAAGEVLEAFSFPHLVAGWMRGSHHGPLIPVPQRYAKVTRFDGPPRVMALGW
NIAKGKLIGPVDLFDDVAFDETRRLAVQIAEYMRRHGPFMPHRLGPEEMEYTTLPAVLEK
LKDRFVKTEEVHVIRRHSELLSGTSEEEQK
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaggtgaaaagataactttatcagttatcaaggcagacgttggatcaatctct
ggacatgtaatgccccatcccgatcaattagcagcagccactaaggtattagctgaagct
aagcagaagggattattaatagacttccatgtaacacacgttggtgacgacatacagctg
ataatgactcatagaaaaggagttgatgctccggaaatacatgagctagcatggaacgct
tttaaagctgcagcgaaggttgctagagagctgaaactatatgctgctggtcaagacttg
ttaagtgatgcattctcaggaaatgtcagaggccttggtccgggtgttgcagaaattgag
atggttgagagaaaagcagaaccagtgattacattccacgcggataagactgagcctgga
gcatttaatttacctatcttcagaatattcgctgatcccttcaatactgctggtttagta
attgatccaagaatgcatgatggcttcatattcgaggtctacgatgtatttgagggcaaa
tctgttaagctaagtgctcctgaggaaatgtatgatatactagctctaataggaacacct
ggcaggtatgtggttagaagagtttatagaaaaagcgacaacttacaagcagctgtcgta
agtgttgaaaggctcaacttgattgcaggaaaatatgttggtaaagacgatcctgtagct
atagttagagcacagcatggattaccagctgcaggagaggtgcttgaagcattctcattc
ccacatctagtagctggatggatgcgtggaagccaccatggaccattaatacctgtccca
cagagatacgctaaagttacaagattcgatggaccaccacgtgtgatggcgcttggctgg
aacattgctaaaggaaaactcattggcccagtagacttattcgacgacgtagcattcgat
gagacaagaagactagctgtacaaatagcagaatacatgaggcgccacggaccattcatg
ccacaccgtctaggaccagaagaaatggaatatacaacattacccgctgtattagagaag
cttaaagatagatttgtgaagacagaggaagtccatgtaattagaaggcatagtgaatta
ttatctggaactagcgaagaagaacaaaaataa

DBGET integrated database retrieval system