KEGG   Staphylothermus hellenicus: Shell_1566Help
Entry
Shell_1566        CDS       T01249                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
shc  Staphylothermus hellenicus
Pathway
shc00010  Glycolysis / Gluconeogenesis
shc00051  Fructose and mannose metabolism
shc00562  Inositol phosphate metabolism
shc01100  Metabolic pathways
shc01110  Biosynthesis of secondary metabolites
shc01120  Microbial metabolism in diverse environments
shc01130  Biosynthesis of antibiotics
shc01200  Carbon metabolism
shc01230  Biosynthesis of amino acids
Module
shc_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:shc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shell_1566
   00051 Fructose and mannose metabolism
    Shell_1566
   00562 Inositol phosphate metabolism
    Shell_1566
Enzymes [BR:shc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Shell_1566
Exosome [BR:shc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Shell_1566
  Exosomal proteins of bladder cancer cells
   Shell_1566
  Exosomal proteins of melanoma cells
   Shell_1566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG IGPS Trp_syntA His_biosynth FMN_dh NMO CutC
Motif
Other DBs
NCBI-ProteinID: ADI32654
JGI: Shell_1566
UniProt: D7DA58
Position
1494241..1494942
Genome map
AA seq 233 aa AA seqDB search
MSLKPIVAVNYKAYYPYSFGEHAVQIARDAVKVWKETGVDIILAPPYTELYRVLKEVEGT
DIKVFAQHADPVEPGAKTGYIPLEALKELGVHGVILNHSEHRLKLADINWLVKKAKKLGL
QTLVCADVPETGAAVAVLEPDMVAVEPPELIGTGIPVSKAKPEVITRSVELIRKVNKDVI
ILTGAGISRGEDVYAAVKLGTLGVLVASAIVKSDNPYQVIKDMALNGLKALEK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
ttgagtttaaaacctattgttgcagtaaattataaagcatattatccctacagcttcgga
gaacatgctgtacaaatagctagagacgctgttaaagtatggaaggaaacaggtgtagat
attattctggcaccaccatatacggagctttaccgtgtattaaaagaagtagagggtaca
gacattaaagtattcgctcaacacgctgaccctgtagaaccaggtgctaagacaggatac
attccattagaagctttaaaagagctaggtgttcacggagtaattcttaaccatagcgag
catagattgaaactagctgatataaactggttggtcaagaaagctaagaagcttggatta
caaacacttgtatgtgcagatgttccagaaacaggtgcagcagtcgctgttctagaacca
gatatggttgctgttgagcctccagagcttataggaacaggtatacctgttagcaaagct
aaacccgaagttataacacgaagtgttgagctgataaggaaggtaaataaagacgtaata
atacttacaggcgcaggtattagtagaggagaagatgtatatgccgctgtaaaacttgga
acactaggagtactagtagcatcagcaatagttaaatccgataatccgtaccaggtaata
aaagatatggcgctaaatgggttaaaagcattagaaaaataa

DBGET integrated database retrieval system