KEGG   Staphylothermus hellenicus: Shell_1584Help
Entry
Shell_1584        CDS       T01249                                 

Definition
(GenBank) Pyridoxal-5'-phosphate-dependent protein beta subunit
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
shc  Staphylothermus hellenicus
Pathway
shc00260  Glycine, serine and threonine metabolism
shc01100  Metabolic pathways
shc01110  Biosynthesis of secondary metabolites
shc01120  Microbial metabolism in diverse environments
shc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:shc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Shell_1584
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Shell_1584
Enzymes [BR:shc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Shell_1584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP TF_Zn_Ribbon zf-NADH-PPase zf-TFIIB HypA A2L_zn_ribbon DUF3791 NRDD OrfB_Zn_ribbon
Motif
Other DBs
NCBI-ProteinID: ADI32672
JGI: Shell_1584
UniProt: D7DA76
Position
complement(1510802..1511872)
Genome map
AA seq 356 aa AA seqDB search
MIEKKDAYWYCPKCGFKESIWNKYYWKCPRCGSPLKIIYDKTFEPRGNGLPRYSSLFPFK
PVKTIGEGGTPLVIDEENNVKLLFKLEYLNPSGSFKDRGTALAIGYSYLLGYKSVVEDTS
GNTGISVTLYSRVYGLKPLIIMPKNAPLGKKKLVKLLGGKIVEAKNRGEASKIVSNYIES
SYYVAHTWSYFYIIGASTISYEVYEEYGVPDYVIVPVGSGGLFLGLMNGFEHLYIQGLIR
HVPKPVVVQGYSVQPVYEKLYGKKIGGEESDLADGIMVPNPPRINEILEYMGKYGGKIVL
VGNSEIKQALLELLDKGFIVEPTSAAVYAAYKKMIDEFRGKEVLLPLTGSGLKMVS
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgattgagaaaaaagatgcttattggtattgtccgaaatgcggcttcaaagaatctatt
tggaacaaatattattggaaatgccctagatgcggctcacctctcaaaataatatatgat
aaaacatttgaacccagaggcaacggattacctagatatagttcattgttccctttcaag
cccgttaaaactattggtgagggaggaacacctctagttatagatgaggaaaacaatgtt
aagttattgtttaagctagaataccttaatccttcaggaagcttcaaggatcggggaaca
gcgcttgctattggatatagttatcttttaggatataaatctgtagtagaggatacaagt
ggaaatacaggtatatctgttactttatattctagggtgtatggattaaaacctttgatt
ataatgcctaaaaatgctcccctggggaaaaagaagctagttaaattattgggtggtaaa
atagttgaggctaaaaatagaggtgaagcttctaagattgtttcaaactatattgagtcc
tcatattatgtagctcatacatggagctacttctacattattggtgcttcaacgatttct
tatgaagtatatgaggaatacggtgtacccgattatgtgattgtaccggtgggttcgggc
ggattattcctaggattaatgaatggtttcgagcatctatatattcaaggattaataaga
catgttcctaaaccagtagttgttcagggatatagtgttcagccagtttatgaaaaacta
tatggtaagaaaattggtggcgaagaatcagatctagccgatggtataatggttcctaac
cctccccgtatcaatgaaatattagagtatatgggaaaatatggtggcaaaatagttctt
gttggaaatagtgagattaaacaagctcttctagaactattagataaaggattcattgtt
gaaccaacctcagctgcagtatatgctgcatataagaagatgatagatgaatttagaggt
aaagaagtattgttgccattaacaggttcaggattaaaaatggttagctaa

DBGET integrated database retrieval system