KEGG   Sulfuritalea hydrogenivorans: SUTH_00537Help
Entry
SUTH_00537        CDS       T03591                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
shd  Sulfuritalea hydrogenivorans
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:shd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SUTH_00537
   00630 Glyoxylate and dicarboxylate metabolism
    SUTH_00537
   00640 Propanoate metabolism
    SUTH_00537
   00650 Butanoate metabolism
    SUTH_00537
  Lipid metabolism
   00071 Fatty acid degradation
    SUTH_00537
   00072 Synthesis and degradation of ketone bodies
    SUTH_00537
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SUTH_00537
   00310 Lysine degradation
    SUTH_00537
   00380 Tryptophan metabolism
    SUTH_00537
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SUTH_00537
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SUTH_00537
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SUTH_00537
Enzymes [BR:shd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SUTH_00537
Exosome [BR:shd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SUTH_00537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
534894..535931
Genome map
AA seq 345 aa AA seqDB search
MDEVIMGCVLPAGQGQAPARQASLGAGLPLAAGCTTVNKMCGSGMRAAMYAHDMLLAGSV
DVMVAGGMESMSNAPYLLPKARGGYRLGHGEVKDHMFLDGLEDAYDKGRLMGTFAEDCAG
SYKFTREAQDAFAVASTTRAKQANTDGSFTWEIAPVTVSGRKGDVVIDKDEQPFKAQLEK
IPTLKPAFRKDGTVTAANSSSISDGAAALVMMRASTAARLGLKPIATIVGHSTFAQEPGL
FTTAPVGAMKKLLAKNGWSADSVDLWEINEAFAVVTMAAMHDLKLPHEKVNVHGGACALG
HPIGASGARVIVTLIGALRKYGKKRGVASLCIGGGEATAVGIELV
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtggatgaagtcatcatgggctgcgtcctgcccgccggccagggccaggccccggcgcgc
caggcttcgctcggggccggactgccgctggcggccggctgcaccacggtgaacaagatg
tgcggctcgggcatgcgcgccgcgatgtacgcccacgacatgctgctggccggcagcgtg
gacgtgatggtcgccggcggcatggagtcgatgagcaacgcgccttacctcttgcccaag
gcgcgcggcggttaccggttgggccacggcgaggtcaaggaccacatgttcctcgacggc
ctcgaagacgcctatgacaagggccgcctgatgggcaccttcgccgaggattgtgccggc
agttacaagttcacccgcgaagcgcaggacgcttttgccgtcgcctcgaccacccgggcc
aagcaggccaataccgacggttccttcacctgggaaatcgccccggttaccgtttccggc
cgcaagggtgacgtcgtcatcgacaaggacgagcagcccttcaaggcgcaacttgaaaag
atcccgacgctgaagccggccttccgcaaggatggcacggtgaccgccgccaactcctcg
tcgatctccgacggcgccgccgcgctggtgatgatgcgcgcctcgaccgccgccaggctt
ggtctcaagcccatcgccactatcgtcggccacagcactttcgcccaggagcccggcttg
ttcaccacggcgccggtcggcgccatgaagaagctgctggcgaagaacggctggagcgcg
gacagcgtcgatctctgggaaatcaatgaagccttcgccgtcgtcaccatggcggcgatg
cacgacctcaagctgccgcacgagaaggtcaacgtgcatggcggcgcctgcgcgctgggc
cacccgatcggagcttccggcgcgcgcgtcatcgtcaccctgatcggcgcgctgaggaaa
tacggcaagaagcgcggcgtcgccagcctttgcatcggcggcggcgaagcgacggcggtc
ggcatcgagctcgtttag

DBGET integrated database retrieval system