KEGG   Shewanella sp. MR-4: Shewmr4_0064Help
Entry
Shewmr4_0064      CDS       T00388                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
she  Shewanella sp. MR-4
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:she00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Shewmr4_0064
Enzymes [BR:she01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Shewmr4_0064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(74168..75652)
Genome map
AA seq 494 aa AA seqDB search
MKNQVQLITYVDRITGAGLKQLKALLDNELDGLFGGVHLLPFYYPIDGSDAGFDPIDHVQ
VDSRLGDWDDVKNIGEAFDIMADLIVNHMSAESPEFKDVLKHGKQSVYWDLFLTKDKVFP
EGLSEQDQKAIYRPRPGSCFSTYTLADGSTEEFWTTFTRNQIDIDVNSAAGKDYLNRVLA
RFNHSKVNLIRLDAAGYAIKKPGTSCFMIEESFEFVDKLAKQANELGMTTLAEIHSHHMT
QIDIAKRVDMVYDFALPPLILHTLFSQDCSALSHWLDMAPRNCITVLDTHDGIGIIDVGP
MDGLRGLLDEKQIDNLVETIHGNSQGESLQATGAAASNVDLYQINCTYYDALGQNDLDYL
MARAIQFFAPGIPQVYYTGLLAIPNDMTLLNQTHVGRDINRPYLNREKVQQALQKPVVKA
LIQLIKLRNKSAAFNGRFSMAASGKTLTLTWSAQNASASLSLDFAHKQGLITLLDEQGIE
TQIALADLLTQAQA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcaagtgcaattgatcacctatgtcgatcggataaccggtgccggactcaaa
caactcaaagccttactcgataatgagttagatggtttatttgggggcgttcatctactg
cccttttactatcccatcgatggcagcgatgcggggtttgatcccatagaccatgtacaa
gtggactcacgcttaggtgattgggacgatgtcaaaaacataggcgaagcgttcgacatc
atggccgacttgatcgttaaccacatgtccgcagaatctcccgagtttaaagatgtgctc
aagcatggcaaacaatcggtttactgggatttattcctgaccaaggacaaggtattccct
gagggattaagtgaacaggatcaaaaagctatctatcgcccccgcccagggagctgcttt
agcacttacaccttagcggatggttcaacggaagaattttggaccacctttacccgtaac
cagatcgatatcgatgttaactcagctgcaggtaaggattatttaaaccgcgtattggcg
cgatttaaccacagcaaagtcaatttaatccgcttagatgccgcagggtatgcaatcaaa
aagcccggtactagctgctttatgattgaggaatccttcgagtttgtggataaattagcg
aagcaagctaatgagttaggtatgacaaccctagccgaaatccactcccatcatatgacg
caaatcgatatcgccaaacgagtggacatggtttacgacttcgccctgccaccgctcatc
ctgcacacgctgtttagccaagattgtagcgccctgagtcactggctagacatggcccct
cgcaactgcatcacagtactcgatacccacgatggcattggtattatcgatgtcggccca
atggatggcttacgcggattattggacgaaaaacaaatcgataatctggtcgaaaccata
cacggcaacagtcaaggcgagagtctacaagccacaggggcggccgccagcaatgtcgat
ttgtatcaaatcaactgcacttattacgatgccctagggcaaaatgatctagattacttg
atggcgcgagcaattcagtttttcgcaccgggtattccgcaggtctactacacaggcctg
cttgccataccaaacgacatgacgttgctgaatcaaacccacgtcggccgagacattaat
cgcccctatttaaaccgggaaaaagtgcaacaagccctgcaaaaacctgtggttaaagcc
ctcatccaattgattaaactgcgtaataagagcgcagcattcaatggccgcttttcgatg
gcagcaagtggaaaaacactaactctcacatggtctgcacaaaatgcatcggccagtctt
agtctcgactttgcccataaacaagggctgatcaccctacttgatgagcaaggcatcgaa
acccaaatcgcattagcagacctgctcactcaagcacaggcctaa

DBGET integrated database retrieval system