KEGG   Shewanella sp. MR-4: Shewmr4_0952Help
Entry
Shewmr4_0952      CDS       T00388                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
she  Shewanella sp. MR-4
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:she00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Shewmr4_0952
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Shewmr4_0952
Enzymes [BR:she01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Shewmr4_0952
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1114486..1115604
Genome map
AA seq 372 aa AA seqDB search
MNLSEIAYRRVVVKLGTSVLTSGSKQLDKAHMVELARQMAALMRSGVEVVLCTSGAIAAG
REHLQYPVLPDTMANKQLLAAVGQSQLILAWAQLFSIYGLHVGQLLLTRADLHDRERYLN
ARDTLNALLANNIIPIINENDAVATNEIKVGDNDNLSARAALLCDADLLILLTDQKGLFD
ADPRTNPNAKLISQVEKIDDSLRLLAGGSVSGLGTGGMSTKLEAADIARRAGIEVVIASG
HHPDVIKKVVGKESVGTHFSAIENPLESRKQWILAGPAAQGSLVLDAGAVKAVTEKGRSL
LSKGIIGVKGEFERGATLQLVDQKGKIIARGITRYCGEALGVIAGKHSDEIESVLGYDYG
DAIVHRNDMVVL
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaagtgagatagcgtatcgccgcgtggtagtgaagttagggacgagtgtgctg
acttctggcagtaaacagctggataaagcccatatggttgagcttgctcgtcaaatggcc
gcactgatgagatcaggggtcgaagtcgtattatgcacttctggcgcaattgccgccgga
cgcgaacatctccaatacccggtattgcccgacactatggctaacaaacagttattagcc
gctgtcgggcagagtcagcttattctcgcttgggcacaactctttagtatctatggtttg
catgtggggcaattgctgctaacccgtgccgatctacacgatagagagcgctatttaaat
gcccgcgatacgcttaatgccttgctggcaaacaatattatccccatcatcaacgaaaac
gatgccgtcgctactaatgagatcaaagtgggcgacaacgataacttgtcggcgcgtgct
gcactgctgtgtgatgccgacctgttgattttgttgacggatcaaaagggcttattcgat
gccgatccgcgcactaacccgaatgctaagctgatttctcaggtcgagaaaattgatgac
agtctgcgtctgttagcgggtggttcggtgtcgggcttaggtacgggcggaatgtcgact
aagctagaagctgcggatattgctcgccgtgcgggcattgaagtggtgattgcctcgggt
catcaccccgatgtgattaaaaaagtcgtcggcaaagaatctgtcggcacgcattttagt
gccatcgaaaatccgttagagagccgcaaacagtggattttagcgggacccgccgctcaa
ggttcattggtgctcgatgcgggcgcggtgaaagccgtgaccgaaaaaggtcgcagcctg
ctctctaaggggattattggcgtaaaaggtgaatttgaacgtggtgcaaccctgcaattg
gttgaccaaaaaggcaaaatcattgccagaggcatcacccgttactgtggtgaggcctta
ggggtaattgcgggtaaacattccgacgaaatcgagtcagtgctcggttacgattatggt
gacgcaatagtgcaccgcaacgacatggtcgtcttataa

DBGET integrated database retrieval system