KEGG   Shewanella sp. MR-4: Shewmr4_0974Help
Entry
Shewmr4_0974      CDS       T00388                                 

Definition
ribose-5-phosphate isomerase A (EC:5.3.1.6)
Orthology
K01807  
ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
she  Shewanella sp. MR-4
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:she01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:she01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:she00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1141167..1141826)
Genome map
AA seq 219 aa AA seqDB search
MTQDEMKKAAGWAALKYVEKDSIVGVGTGSTVNHFIDALATMKADIEGAVSSSEASTQKM
KALGIPVYDLNSVDKLSVYVDGADEINGHMDMIKGGGAALTREKIVAAVAEKFVCIVDNT
KQVDILGEFPLPVEVIPMARSYVARELVKLGGDPVYREGVVTDNGNVILDVYNLKIINPK
ELEEKINAIVGVVTNGLFAKRGADVLLVGTPEGVKTFTA
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagatgaaatgaaaaaagccgctggctgggctgctctcaaatacgttgagaaa
gacagcattgtgggtgtaggcactggctcaaccgtcaatcactttatcgatgccctcgcc
accatgaaggccgatattgaaggtgcggtatcaagctcagaagcctcaacccaaaaaatg
aaagcccttggcatcccagtttatgacttaaacagcgtcgataaattatctgtgtatgtc
gatggtgccgatgaaatcaacggccatatggacatgatcaaaggcggcggcgcggcatta
acccgcgagaaaatcgttgcggctgtggctgaaaagtttgtctgtatcgtggataacact
aaacaagtggatattttgggtgaattcccactgcccgttgaagtgatcccaatggcgcgt
tcttacgtggcccgtgaactcgtcaaactcggcggcgacccagtgtaccgtgaaggcgtt
gtgactgataacggcaacgtaatcctcgacgtttacaaccttaagatcatcaatcctaag
gaattagaagagaagatcaacgccatcgtcggcgtagtgactaacggtttgttcgcgaaa
cgcggcgccgatgtgttactggttggcacccctgaaggcgtgaaaacctttaccgcttaa

DBGET integrated database retrieval system