KEGG   Shewanella sp. MR-4: Shewmr4_1022Help
Entry
Shewmr4_1022      CDS       T00388                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
she  Shewanella sp. MR-4
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:she00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Shewmr4_1022
   01230 Biosynthesis of amino acids
    Shewmr4_1022
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shewmr4_1022
   00051 Fructose and mannose metabolism
    Shewmr4_1022
   00562 Inositol phosphate metabolism
    Shewmr4_1022
Enzymes [BR:she01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Shewmr4_1022
Exosome [BR:she04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Shewmr4_1022
  Exosomal proteins of bladder cancer cells
   Shewmr4_1022
  Exosomal proteins of melanoma cells
   Shewmr4_1022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1191051..1191833
Genome map
AA seq 260 aa AA seqDB search
MALRRPMVAGNWKMNGSAALAQELFKKFASKLQNDSAEVVLCPPSIYLESVRQLLEANKE
ALDGSLVRMGAQNLSQHDFGAYTGEVSGQMLKDCGCRYVIIGHSERRRMYGETSNIVAEK
FAAAQKHGLTPILCVGESGPAREARRTFEVIAEELDIVIQKNGTMAFDNAIIAYEPLWAV
GTGKSATPEQAQEVHAFIRKRLSEVSPFIGENIRILYGGSVTPSNAADLFAQPDVDGGLI
GGASLNSSEFLSLCTIAMSA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcactcagacgtcctatggtagctggcaattggaagatgaacggcagcgcggcatta
gcccaagagttgttcaagaaatttgcctcaaagctccaaaatgattcagctgaagtggtt
ttatgcccgccttctatctatctagaaagcgtaaggcaactgctagaagcaaacaaggaa
gcgttagacggttcacttgttaggatgggcgctcaaaatttaagtcaacatgactttggc
gcttataccggagaagtttcgggtcagatgcttaaagattgcggatgtcgatatgtgatt
atcgggcattcagaacgtcgccgtatgtacggagagacgagtaatatcgtagcggagaaa
ttcgccgctgcacaaaagcacggtttaacccccattttatgtgtgggtgagtcgggtcca
gcacgagaagcaagacgtaccttcgaggtgattgcggaagagttggatatagtgatccag
aaaaatggcactatggcttttgataacgccattatcgcttacgagccgttatgggctgta
ggaactggtaagagcgcgacaccagagcaggcacaagaagtacatgcgtttattcgcaag
cgtctctctgaagtgtctccgtttatcggagagaatatcaggatcttgtacggtggtagt
gtgacgccgagtaatgcggcagatttattcgcccaacctgatgttgatggtggactgatt
ggcggtgccagtttaaactctagcgagtttttaagtctgtgtaccatagcgatgagcgca
taa

DBGET integrated database retrieval system