KEGG   Shewanella sp. MR-4: Shewmr4_1022Help
Entry
Shewmr4_1022      CDS       T00388                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
she  Shewanella sp. MR-4
Pathway
she00010  Glycolysis / Gluconeogenesis
she00051  Fructose and mannose metabolism
she00562  Inositol phosphate metabolism
she01100  Metabolic pathways
she01110  Biosynthesis of secondary metabolites
she01120  Microbial metabolism in diverse environments
she01130  Biosynthesis of antibiotics
she01200  Carbon metabolism
she01230  Biosynthesis of amino acids
Module
she_M00002  Glycolysis, core module involving three-carbon compounds
she_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:she00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shewmr4_1022
   00051 Fructose and mannose metabolism
    Shewmr4_1022
   00562 Inositol phosphate metabolism
    Shewmr4_1022
Enzymes [BR:she01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Shewmr4_1022
Exosome [BR:she04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Shewmr4_1022
  Exosomal proteins of bladder cancer cells
   Shewmr4_1022
  Exosomal proteins of melanoma cells
   Shewmr4_1022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABI38102
JGI: Shewmr41022
UniProt: Q0HLG5
Position
1191051..1191833
Genome map
AA seq 260 aa AA seqDB search
MALRRPMVAGNWKMNGSAALAQELFKKFASKLQNDSAEVVLCPPSIYLESVRQLLEANKE
ALDGSLVRMGAQNLSQHDFGAYTGEVSGQMLKDCGCRYVIIGHSERRRMYGETSNIVAEK
FAAAQKHGLTPILCVGESGPAREARRTFEVIAEELDIVIQKNGTMAFDNAIIAYEPLWAV
GTGKSATPEQAQEVHAFIRKRLSEVSPFIGENIRILYGGSVTPSNAADLFAQPDVDGGLI
GGASLNSSEFLSLCTIAMSA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcactcagacgtcctatggtagctggcaattggaagatgaacggcagcgcggcatta
gcccaagagttgttcaagaaatttgcctcaaagctccaaaatgattcagctgaagtggtt
ttatgcccgccttctatctatctagaaagcgtaaggcaactgctagaagcaaacaaggaa
gcgttagacggttcacttgttaggatgggcgctcaaaatttaagtcaacatgactttggc
gcttataccggagaagtttcgggtcagatgcttaaagattgcggatgtcgatatgtgatt
atcgggcattcagaacgtcgccgtatgtacggagagacgagtaatatcgtagcggagaaa
ttcgccgctgcacaaaagcacggtttaacccccattttatgtgtgggtgagtcgggtcca
gcacgagaagcaagacgtaccttcgaggtgattgcggaagagttggatatagtgatccag
aaaaatggcactatggcttttgataacgccattatcgcttacgagccgttatgggctgta
ggaactggtaagagcgcgacaccagagcaggcacaagaagtacatgcgtttattcgcaag
cgtctctctgaagtgtctccgtttatcggagagaatatcaggatcttgtacggtggtagt
gtgacgccgagtaatgcggcagatttattcgcccaacctgatgttgatggtggactgatt
ggcggtgccagtttaaactctagcgagtttttaagtctgtgtaccatagcgatgagcgca
taa

DBGET integrated database retrieval system