KEGG   Shewanella sp. MR-4: Shewmr4_1140Help
Entry
Shewmr4_1140      CDS       T00388                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
she  Shewanella sp. MR-4
Pathway
she00260  Glycine, serine and threonine metabolism
she00750  Vitamin B6 metabolism
she01100  Metabolic pathways
she01110  Biosynthesis of secondary metabolites
she01120  Microbial metabolism in diverse environments
she01230  Biosynthesis of amino acids
Module
she_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:she00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Shewmr4_1140
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Shewmr4_1140
Enzymes [BR:she01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Shewmr4_1140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ABI38220
JGI: Shewmr41140
Position
1341051..1342334
Genome map
AA seq 427 aa AA seqDB search
MELYNLKHPSQKVSFKEAVQLGLGKDRGLFFPTQIPVLHDIEALLAMPFVERSKKVLGAW
LASELGQGAVDKLVERAFNFDLPLVAVDEQRSCLELFHGPTLAFKDFGARFMAQCINAFA
QDSRLTILTATSGDTGAAVADAFYGLDKVNVVVLYPKGKISELQEKMFTTLGKNIHTVAV
ASDFDACQHLVKQAFEDSDVRDGLHLNSANSINISRLLAQICYYFEAVAQSKQRHEADPV
IAVPSGNFGNLTAGLFAKAMGLPVKRFIAATNANDTVPRYLESGDWQPNPTQATMSNAMD
VSEPSNWPRVEAICEKLGWPLSDLVGIRLSEAQTSEALAELQAKGYVSEPHAAIAAKALS
LNLVPDEVGIFLGTAHPAKFKDVVDRELNLDLPLPAELKAVEHKPILSAELAADFAQLKS
HLFAVLS
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggaactatataatttaaaacacccttcgcagaaagtgagctttaaggaagcggtgcaa
ttaggactcggtaaagacagagggttgttttttcctactcaaatcccagtgttgcacgat
attgaggcgctgctggcaatgccttttgtcgagcgcagtaaaaaagtgctcggcgcttgg
ctcgcctcagagcttgggcaaggcgcggtagataagctagtcgagcgtgcctttaatttc
gatttgcccttggtggcggtcgatgagcagcgctcgtgcctcgagcttttccatgggcca
actttagcattcaaggattttggtgcgcgctttatggcgcaatgcatcaatgcctttgct
caagactcgcgcttaaccattctaaccgcgacctcgggtgacactggggcggcggtggcc
gatgccttttacggcctagataaagtcaatgtagtcgtgctctatcctaagggcaaaatc
agtgagctacaggaaaagatgttcaccaccttaggtaagaacatccacactgtggcagta
gcgtccgatttcgatgcttgccagcacttagtcaaacaggcttttgaagatagcgatgtg
cgtgatggcttgcatttaaactcggccaactcaatcaacatcagtcgtttactggcacag
atttgttattacttcgaagcggtcgcccaatcgaaacagcgccatgaggccgatcctgtg
attgccgtgcccagtggaaactttggaaacttgaccgcgggattatttgccaaagccatg
ggcttacctgttaaacgttttattgccgccaccaacgccaatgacactgtcccacgttat
ttagagagtggtgattggcaacccaatcccactcaagcgactatgtccaatgcgatggat
gtgagcgagccaagtaactggccgcgcgtcgaggctatttgcgagaaactcggttggcca
ctttcggacttagtgggtattcgcctgtctgaggctcaaacctcggaggccttggcggaa
ttacaagctaagggctatgtgtctgagccccatgcggcgattgcggctaaggcgttatcg
ctcaacttagtgcctgatgaagtggggatatttttaggcacggcgcatcccgccaagttt
aaggatgtcgtagatagagagcttaacctcgatttacctttgcctgcagaacttaaggcg
gtggagcataaacctatactctcggctgaattagccgccgattttgcccagctaaagtca
catttatttgcggtgttaagctga

DBGET integrated database retrieval system