KEGG   Shewanella sp. MR-4: Shewmr4_1196Help
Entry
Shewmr4_1196      CDS       T00388                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
she  Shewanella sp. MR-4
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:she00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Shewmr4_1196
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Shewmr4_1196
Enzymes [BR:she01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Shewmr4_1196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1399293..1399904
Genome map
AA seq 203 aa AA seqDB search
MISILVSDVIENNELANLGAPNEKDIMMKLPLVIFASLLSTSAFAATCPSYLGVEVRKLH
SDEKINLCELTQGKPVLLVNTASNCGYTPQFKALEALHKEYKDKGLVVIGFPSDDFFQEE
NDEKDTAKVCYINYGVTFTMLATSPVRGSDANSVFKYLGDKAGSPKWNFYKYVVSGDGNT
VQQFNSKVKPDSAELKQAIESVL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgatctctatattagtgagtgacgtaatagagaataacgagttagccaatcttggcgcg
cccaatgagaaggacattatgatgaaactccccttagttatctttgctagcctgttaagc
actagcgcatttgcggcaacttgcccgagttatctgggtgttgaagtgcgtaaattgcac
tcggatgagaagattaatctgtgtgaattgactcagggcaagccagtgttactggtcaac
actgcgagtaactgtggctacactccgcaatttaaggccctcgaagcgcttcataaagaa
tacaaagacaaaggcttagtggtgattggtttcccttccgatgactttttccaagaggaa
aatgatgaaaaagacacggctaaggtgtgctacatcaactatggtgttaccttcactatg
ctcgcgacatcgcccgtgcgaggcagcgatgctaacagtgtattcaaatacttaggagat
aaagctggctcgcctaagtggaatttctacaagtatgtcgtcagtggcgatggcaatact
gtgcagcagtttaattctaaggtgaaacccgatagtgccgagcttaagcaggcaatagaa
tcagtgctttaa

DBGET integrated database retrieval system