KEGG   Shewanella sp. MR-4: Shewmr4_1303Help
Entry
Shewmr4_1303      CDS       T00388                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
she  Shewanella sp. MR-4
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:she00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Shewmr4_1303
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Shewmr4_1303
Enzymes [BR:she01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Shewmr4_1303
Two-component system [BR:she02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Shewmr4_1303
Bacterial motility proteins [BR:she02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Shewmr4_1303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1510761..1511879
Genome map
AA seq 372 aa AA seqDB search
MAIKVLVVDDSSFFRRRVSEIVNQDPELEVIATASNGAEAVKMAAELNPQVITMDIEMPV
MDGITAVREIMAKCPTPILMFSSLTHDGAKATLDALDAGALDFLPKRFEDIATNKDDAIL
LLQQRVKALGRRRIFRPVVRPTTPTPPPRSSASSVLGGVSTHTQPAPVRSSHAASIRPSG
KQYKLLLIGTSTGGPVALQKILTQFPANYPHPILLIQHMPAAFTPAFANRLNGLCKIEVK
EAANGDVLRPGCAYLAPGGMQMMVERTGVTGRVKVLAGSAEMNYKPCVDITFASASKAFG
GDVLAVVLTGMGADGREGARMLKSAGATIWAQDEASCVVYGMPQAVASAGIATQSISLDN
MAESILKESARG
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggccattaaagtattagtcgttgatgactcaagtttttttagacgacgtgttagtgaa
atagtcaatcaagatcctgaactggaagtgatcgcaacggcctctaacggggccgaagcg
gtgaagatggctgccgaacttaatccgcaagtcattacaatggacattgaaatgcctgta
atggatggtattactgctgtccgtgagattatggcgaagtgtccaacgcctatcttgatg
ttttcttcattgacccatgatggtgccaaggccacgcttgatgcccttgatgcgggggcg
cttgattttctacctaagcgattcgaagatatcgcgaccaataaagatgacgctattttg
ctattgcagcaaagagtcaaggctttaggtcgtcgccggattttccgtcctgtggtacgt
cctaccacaccaacgccgccacctcgttcgagtgcgagttcagtattaggtggggtatcg
acacatacgcagcctgcaccagttcgttcttcacatgctgcatctattcgtccaagtggt
aaacaatataagttattgctgataggcacatcgacgggcgggcctgttgctttgcagaaa
attttgactcagttccccgcaaattatccgcatcctattttgcttatccagcatatgcca
gcggcctttacgccagcctttgcgaatcgtttaaatggtttgtgtaagattgaagtcaaa
gaagcggcgaatggtgatgtattgcgtccaggatgcgcgtatttagcgcctggcgggatg
caaatgatggttgagcggacaggtgtcacgggccgtgtcaaagtgttggcaggaagcgct
gagatgaattacaagccctgtgttgatatcacctttgcttctgcctcaaaagcctttggc
ggtgatgtgctggcggtagtgttgacaggaatgggagccgacggccgcgaaggtgcgcgt
atgctgaaatccgcgggcgcgaccatttgggcacaggatgaagcgagttgtgtggtttat
ggtatgccgcaggcggtggccagtgccggtatagctactcagtctatttcgctggacaat
atggctgagtcgattttaaaagagtctgcgcgtggctaa

DBGET integrated database retrieval system