KEGG   Shewanella sp. MR-4: Shewmr4_1408Help
Entry
Shewmr4_1408      CDS       T00388                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase / short chain enoyl-CoA hydratase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
she  Shewanella sp. MR-4
Pathway
she00071  Fatty acid degradation
she00280  Valine, leucine and isoleucine degradation
she00281  Geraniol degradation
she00310  Lysine degradation
she00362  Benzoate degradation
she00380  Tryptophan metabolism
she00410  beta-Alanine metabolism
she00640  Propanoate metabolism
she00650  Butanoate metabolism
she00903  Limonene and pinene degradation
she00930  Caprolactam degradation
she01040  Biosynthesis of unsaturated fatty acids
she01100  Metabolic pathways
she01110  Biosynthesis of secondary metabolites
she01120  Microbial metabolism in diverse environments
she01130  Biosynthesis of antibiotics
she01200  Carbon metabolism
she01212  Fatty acid metabolism
Module
she_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:she00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Shewmr4_1408
   00650 Butanoate metabolism
    Shewmr4_1408
  Lipid metabolism
   00071 Fatty acid degradation
    Shewmr4_1408
   01040 Biosynthesis of unsaturated fatty acids
    Shewmr4_1408
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Shewmr4_1408
   00310 Lysine degradation
    Shewmr4_1408
   00380 Tryptophan metabolism
    Shewmr4_1408
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Shewmr4_1408
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Shewmr4_1408
   00281 Geraniol degradation
    Shewmr4_1408
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Shewmr4_1408
   00930 Caprolactam degradation
    Shewmr4_1408
Enzymes [BR:she01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Shewmr4_1408
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Shewmr4_1408
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Shewmr4_1408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 LEM
Motif
Other DBs
NCBI-ProteinID: ABI38486
JGI: Shewmr41408
UniProt: Q0HKD1
Position
1639736..1641865
Genome map
AA seq 709 aa AA seqDB search
MEKTFNLTRREDGIAILTMDVPGETMNTLKAEFGPEISEILSEIKRDSSIRGLVLISGKK
DSFVAGADISMLDACQTAGDAKALSQQGHVVFNELEALNIPVVAAIHGACLGGGLELALA
CHQRVCSDDGKTMLGVPEVQLGLLPGGGGTQRLPRLVGITTALDMMLTGKQIRPKQALKM
GLVNDVVPQTILLQTAVEMALAGKRTAKPVKKSLVNQLLEGTGFGRNIIFDQAAKQVAKK
TQGNYPAPAKIIDCVRQGMAKGMQKGLEVEASHFAELVVSKESEALRSIFFATTEMKKET
GAEGATPRKVKKAVILGGGLMGGGIASVTTTKAKIPARVKDINEKGLSNALSYAYKLLDK
GVKRRHMTPAVRDNLMALMTTTTEYKGVKDADIVVEAVFEDLALKHQMVKDIERECGEHT
IFASNTSSLPIGQIAQAASRPENVIGLHYFSPVEKMPLVEVIAHAKTSPETIATTVAFAR
KQGKTPIVVQDGAGFYVNRILALYMNEAAQLLLEGQSIEHLDKALVKFGFPVGPITLLDE
VGIDVGAKIAPILEKELGERFKAPAAFDKLLSDDRKGRKNGKGFYQYAAGNKAPSKKKAV
DESVYGVLGIKPGIDKEMSAVAERCVVQMLNEAVRCLDDGIIASPRDGDIGAIFGIGFPP
FLGGPFHYIDTLGADNLVKILERYQAQYGDRFEPCPRLKEMAAEKTRFF
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagacatttaatttaacccgccgtgaagacggtatcgccattctaacgatggac
gtacccggcgaaaccatgaataccctcaaggcagaatttggccctgagatcagtgagatt
ctgtctgagattaaacgcgatagcagtatccgtggcctagtgctgatttcgggtaaaaaa
gactccttcgtagctggggcggatatctctatgctcgacgcttgccaaacggcgggcgat
gctaaagccttatcccaacaagggcatgtggtgtttaacgagttagaagccttgaatatc
cctgtggttgccgcgatacatggcgcttgtttagggggcggtttagagcttgcgcttgca
tgccatcaacgtgtgtgtagtgatgatggcaagaccatgctgggtgtacccgaagtgcaa
ctcggtttattacccggtggcggcggtactcagcgtttgcctcgtttagtggggatcacc
actgccttggatatgatgttgactggtaaacaaatccgtccgaaacaagcgttaaagatg
ggcttagttaacgatgtggtgccacagacgattttactgcaaaccgcggtggaaatggcg
ctcgcgggtaagcgcacggcgaaaccagttaaaaaatcgctggtcaatcaattactcgaa
ggtacaggattcggtcgtaacattattttcgatcaagccgccaagcaagtcgctaagaaa
acccaaggcaactatcctgcgccggcaaaaattattgattgcgtgcgccaaggtatggct
aagggaatgcaaaaagggcttgaggtggaagccagccattttgcagagctggtggtgtcg
aaagaatcagaggcgctgcgcagtattttctttgccaccacagagatgaagaaagaaact
ggcgccgaaggggcgacaccacgtaaagtcaaaaaagccgtgatcttaggtggcggtttg
atgggcggtggtattgcttcggtcacgacgactaaggctaaaattcctgcaagggtaaaa
gacattaacgaaaagggcttaagcaatgcgctttcttacgcctataagttattggataaa
ggcgttaaacgtcgtcatatgacgccagccgttcgcgacaatttaatggcactgatgaca
acgacgaccgaatataaaggcgttaaggacgctgatattgttgttgaagccgtatttgag
gatttagcgcttaaacatcagatggttaaagatattgagcgtgaatgcggtgagcacacg
atttttgcatctaacacctcatctttacccattggccaaattgcacaagcggccagccgt
cctgaaaatgtgattggcttacattatttctcaccagtagaaaaaatgccgttggtggaa
gtgattgcccatgcgaaaacgtctcctgagacgattgctaccacagtggcctttgcccgc
aaacagggtaaaacgccaatcgtggtacaagacggtgccggtttttatgttaatcgtatc
ctcgcactttacatgaacgaagctgcgcaattgctgctggaagggcagagtattgagcac
ttagacaaagccttagtgaagttcggtttccccgttggccctatcactctgctcgatgaa
gtgggtatcgatgtgggtgctaaaatcgctccaatccttgaaaaagaactgggtgagcgc
tttaaagcccctgcagccttcgataagttactgagcgatgatagaaaaggccgtaaaaat
ggcaaaggtttctatcaatatgctgctggcaataaagcgccgagcaagaagaaagccgtg
gatgaaagtgtatatggcgtattaggtatcaaaccgggtatcgataaagaaatgagcgcg
gtagcggaacgttgtgtcgtgcaaatgctcaatgaagctgtgcgctgcttagatgacggc
attattgcttcaccacgcgatggtgatattggcgctatcttcggtattggtttcccacca
ttcttgggtggcccattccactatatcgatactctaggggccgataacttagtcaagata
ctggaacgttaccaggctcaatacggcgaccgatttgagccatgtccacgtcttaaggag
atggcggcagaaaagacacgtttcttctaa

DBGET integrated database retrieval system