KEGG   Shewanella sp. MR-4: Shewmr4_1457Help
Entry
Shewmr4_1457      CDS       T00388                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
she  Shewanella sp. MR-4
Pathway
she00260  Glycine, serine and threonine metabolism
she00400  Phenylalanine, tyrosine and tryptophan biosynthesis
she01100  Metabolic pathways
she01110  Biosynthesis of secondary metabolites
she01130  Biosynthesis of antibiotics
she01230  Biosynthesis of amino acids
Module
she_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:she00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Shewmr4_1457
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Shewmr4_1457
Enzymes [BR:she01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Shewmr4_1457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA
Motif
Other DBs
NCBI-ProteinID: ABI38535
JGI: Shewmr41457
Position
complement(1705126..1705962)
Genome map
AA seq 278 aa AA seqDB search
MSNTATQTIPHQAGRYHAAFSRLKAEGRGAFVPFVTLGDPSPELSLKIIDTLVQNGADAL
ELGFPFSDPLADGPVIQGANLRALAAGTTPTQCFNLLAQIRAKYPELPIGLLLYANLVFA
NGIDAFYAKAQQAGVDSVLIADVPVEEAAPFIQAAKAHGIAPIFIAPPNADSDTLEKVSQ
SGEGYTYLLSRAGVTGTDTKAGTPVEEILAKLQAFNAPPPLLGFGIAEPAQVSAAIQAGA
AGAISGSAVVKIIEAHQQDEAKLLSTLGEFTRAMKAAT
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacactgcaacccaaactatccctcatcaagctggacgttatcacgccgctttt
agccgtttaaaagccgaaggccgcggcgcctttgtgccctttgttactttgggcgatcca
agccctgagctgtcactgaaaattatcgacaccttagtgcaaaatggtgccgatgcactg
gaattaggctttcccttctccgatccgctggcagacggccctgtgatccaaggcgcgaac
ctcagagccctcgccgcgggtacgacgcccacacagtgcttcaacttattagcgcaaatt
cgcgcgaaatacccagagctgccaatcgggttattactgtacgcgaacctcgtattcgcc
aatggcatcgatgctttttatgccaaagcgcagcaagcgggcgtggactcagtacttatc
gccgatgtgccagtggaagaagctgcgccatttattcaagccgctaaggcccacggtatc
gcgccgatttttatcgcgccgcccaatgccgatagcgacacccttgaaaaagtgagccaa
agtggcgaaggctatacctatctattgtcccgcgccggtgtaacaggcacagacactaag
gcaggaacgcccgttgaagaaattttagctaagctgcaagcatttaatgcgccgccaccg
ctattaggctttgggattgccgagccggctcaagtgagcgccgccattcaagcgggcgcc
gcgggtgcaatttctggctcggccgtggttaaaattatcgaagctcatcaacaggatgaa
gcaaaactgctgtccaccttgggcgaatttacccgcgcaatgaaagcggcaacctaa

DBGET integrated database retrieval system