KEGG   Shewanella sp. MR-4: Shewmr4_1478Help
Entry
Shewmr4_1478      CDS       T00388                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
she  Shewanella sp. MR-4
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:she01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1732398..1732997)
Genome map
AA seq 199 aa AA seqDB search
MAKAVSACILLSLFITTPVQAAKVLILGDSLGASYGMSEQLGWVALLQKNLPEHEFTNGS
VSGETTAGGLRRLPALLDSVTPDLVVVELGGNDGLRGFPPTQLKNNLIQIITLAKNSGAK
VLLTEIMVPPNYGPRYTQKFTQVYQEIAKDEEIALIPFFMQDIAPHPELMQRDGIHPNEK
AQEKIATWMQPWIEKALTQ
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggccgtgagcgcctgcatcctgttaagtctgtttataaccacgccagttcag
gcggcgaaagtgttgatcctcggcgatagcttaggtgccagctatggcatgtcggaacaa
ttaggctgggtggcgctgctgcaaaaaaatttacccgagcatgaatttaccaatggttcg
gtaagcggtgaaaccacagcgggcggtttgcgtcgtttgcctgcactgctcgattccgta
acccccgatttggtggtggtcgaactcggtggtaacgatggtttacgtggattccccccg
acgcaactcaaaaataacctaatccaaatcattaccctagcgaaaaatagcggtgctaaa
gtgctactgaccgaaatcatggtaccgcctaactatggccctcgctatacccaaaagttc
acccaagtgtatcaagagattgctaaagacgaggagattgcattaatccccttctttatg
caggacattgctccccaccctgagttgatgcaaagggacggaattcatcccaatgaaaag
gcccaagagaagatcgccacttggatgcaaccttggattgaaaaagccttaactcaataa

DBGET integrated database retrieval system