KEGG   Shewanella sp. MR-4: Shewmr4_1478Help
Entry
Shewmr4_1478      CDS       T00388                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
she  Shewanella sp. MR-4
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:she00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Shewmr4_1478
Enzymes [BR:she01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Shewmr4_1478
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Shewmr4_1478
Lipid biosynthesis proteins [BR:she01004]
 Fatty acid synthase
  Component type
   Shewmr4_1478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1732398..1732997)
Genome map
AA seq 199 aa AA seqDB search
MAKAVSACILLSLFITTPVQAAKVLILGDSLGASYGMSEQLGWVALLQKNLPEHEFTNGS
VSGETTAGGLRRLPALLDSVTPDLVVVELGGNDGLRGFPPTQLKNNLIQIITLAKNSGAK
VLLTEIMVPPNYGPRYTQKFTQVYQEIAKDEEIALIPFFMQDIAPHPELMQRDGIHPNEK
AQEKIATWMQPWIEKALTQ
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggccgtgagcgcctgcatcctgttaagtctgtttataaccacgccagttcag
gcggcgaaagtgttgatcctcggcgatagcttaggtgccagctatggcatgtcggaacaa
ttaggctgggtggcgctgctgcaaaaaaatttacccgagcatgaatttaccaatggttcg
gtaagcggtgaaaccacagcgggcggtttgcgtcgtttgcctgcactgctcgattccgta
acccccgatttggtggtggtcgaactcggtggtaacgatggtttacgtggattccccccg
acgcaactcaaaaataacctaatccaaatcattaccctagcgaaaaatagcggtgctaaa
gtgctactgaccgaaatcatggtaccgcctaactatggccctcgctatacccaaaagttc
acccaagtgtatcaagagattgctaaagacgaggagattgcattaatccccttctttatg
caggacattgctccccaccctgagttgatgcaaagggacggaattcatcccaatgaaaag
gcccaagagaagatcgccacttggatgcaaccttggattgaaaaagccttaactcaataa

DBGET integrated database retrieval system