KEGG   Shewanella sp. MR-4: Shewmr4_1636Help
Entry
Shewmr4_1636      CDS       T00388                                 

Definition
2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
she  Shewanella sp. MR-4
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:she01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:she00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:she00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1939224..1940420
Genome map
AA seq 398 aa AA seqDB search
MSIEIKVPVLPESVADATIATWHVKVGEQVSRDQNLVDIETDKVVLEVVAPEDGHIGEFL
FQEGDTVLGEQVIAKFIAGAVSGQEVTKAEAEAAAPVAAAATEESNDALSPSVRRLLAEH
NVDASKVKGTGVGGRITKEDVEAFIKSAPKAAAAPAAPAVQPLAAGRSEKRVPMTRLRKT
IANRLLEAKNSTAMLTTFNEVNMKPIMDIRKQYQDIFEKRHGIRLGFMSFYVKAVTEALK
RFPEVNASIDGDDIVYHNYFDVSIAVSTPRGLVTPVLRDTDTMSLADIEKAVRDLAIKGR
DGKLTVADMTGGNFTVTNGGVFGSLMSTPILNLPQSAILGMHAIKDRPMAVNGQVEILPM
MYLALSYDHRIVDGRESVGFLVAIKDFLEDPTRLLLDL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgaaatcaaggtacccgtactgccagaatctgttgccgacgcaactatcgcc
acttggcacgtaaaagtgggtgagcaagtttctcgtgatcaaaatctggttgatattgaa
actgacaaagtcgtactggaagtggttgcaccagaagatggtcacatcggtgagttcctg
ttccaagaaggtgacaccgttctgggtgagcaagtgattgctaagttcatcgcgggtgcg
gtttctggtcaagaagtgactaaagccgaagctgaagctgctgcacctgttgccgctgct
gcgactgaagagtctaacgatgcattaagcccatcagtccgtcgtttactggctgagcac
aatgttgatgcgagcaaagtgaagggcactggtgtcggtggccgtatcactaaagaagac
gttgaagcctttatcaagtctgcgcctaaagcagctgctgcccctgcggctccagctgta
caacctttagcggcaggtcgtagcgagaagcgtgttccaatgactcgtttacgtaagact
atcgctaaccgtttattagaagcgaaaaactctaccgcgatgctcacgacgtttaacgaa
gtgaacatgaagccaatcatggatatccgtaagcagtaccaagatatctttgaaaagcgc
catggtatccgtttaggtttcatgtctttctacgtgaaagcggtaactgaagcactgaaa
cgcttccctgaagtgaacgcatcaatcgacggtgacgatatcgtttaccacaactacttc
gacgtcagcatcgctgtatcgactccacgtggtctggtcaccccagtactgcgtgatacc
gataccatgagcctggctgatatcgaaaaagcagtacgcgatctggcgatcaaaggccgt
gatggcaagctgactgtggctgatatgactggcggtaacttcactgtgactaacggtggt
gtattcggctcgttaatgtctaccccaattttaaacctgccacaaagcgcgattttaggc
atgcacgccattaaagaccgcccaatggcagtcaatggtcaggttgaaatcctgcccatg
atgtacctagctctctcatatgaccatcgtattgtcgatggccgtgagtcagttggcttc
ttagtcgccattaaagacttcttggaagacccaactcgtctgctacttgacctataa

DBGET integrated database retrieval system