KEGG   Shewanella sp. MR-4: Shewmr4_1637Help
Entry
Shewmr4_1637      CDS       T00388                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
she  Shewanella sp. MR-4
Pathway
she00020  Citrate cycle (TCA cycle)
she00640  Propanoate metabolism
she00660  C5-Branched dibasic acid metabolism
she01100  Metabolic pathways
she01110  Biosynthesis of secondary metabolites
she01120  Microbial metabolism in diverse environments
she01130  Biosynthesis of antibiotics
she01200  Carbon metabolism
Module
she_M00009  Citrate cycle (TCA cycle, Krebs cycle)
she_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:she00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Shewmr4_1637
   00640 Propanoate metabolism
    Shewmr4_1637
   00660 C5-Branched dibasic acid metabolism
    Shewmr4_1637
Enzymes [BR:she01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Shewmr4_1637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABI38713
JGI: Shewmr41637
UniProt: Q0HJQ4
Position
1940540..1941706
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKSLFAEYGLPVSEGFACDTAQEAVEAAGRIGGNLWVVKCQVHAGGRGKAGGV
KVTGDKEEIRAFAEHWLGKNLVTYQTDEKGQPVAKILVESCTDIANELYLGAVVDRATRR
VVFMASTEGGVEIEKVAEETPELIHKAIIDPLTGPQPYQARDLGFKLGLNPTQMKQFTKI
FMGLATMFVDHDFALLEINPLVITTEGNLHCLDGKIGIDGNALFRQPKIKAMHDPSQDDA
REAHAAMFELNYVALDGNVGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVAE
AFKIILSDSNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKVPVVVRLEGTNAELGREV
LAKSGLDIIAANSLTDAAEQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgagtatcaggcaaaatccctatttgccgaatatggtttaccagtgtca
gaaggttttgcatgtgatacagcccaagaagctgtagaagcggcaggccgtattggcgga
aatttatgggttgttaagtgtcaagtacacgcaggcggccgcggtaaagcgggtggcgtt
aaagtcactggcgataaagaagaaatcagagcctttgccgaacactggttaggcaaaaat
ctggtgacttatcaaacagatgagaaaggtcagcctgttgctaaaattttagtagaaagc
tgcaccgacatcgctaacgaactgtacttaggtgcagtagttgaccgtgctacccgtcgc
gtggtgttcatggcttctactgaaggtggtgttgagattgagaaagtggccgaagaaacg
ccagaactcattcacaaagcgatcatcgatccactgactggtcctcaaccataccaagca
cgtgatcttggcttcaaactgggcttaaacccaactcaaatgaagcaattcaccaagatc
tttatgggtctggcgactatgttcgttgatcacgatttcgcactgctggaaatcaaccca
ctggttatcaccactgaaggtaacctgcactgcttagacggtaaaattggtatcgatggt
aacgcactgttccgtcaaccaaaaatcaaagcaatgcacgatccatcacaggatgacgcc
cgtgaagctcacgctgcaatgttcgaactgaactatgttgcgctggacggaaacgtgggt
tgtatggtgaacggtgctggcctagcaatgggtactatggacatcgttaacctgcacggc
ggcaagccagctaacttcctcgacgtaggtggtggcgcgactaaagaacgtgttgctgaa
gcattcaagattattctgtctgacagcaatgtgaaagccgttctggttaacatcttcggt
ggtatcgtacgttgtgacatgatcgcagaaggtatcatcggcgctgttaaagaagttggc
gttaaagttccagttgtagtgcgtttagaaggtactaacgctgaattaggccgtgaagta
ttagctaaatcaggtcttgatatcattgcagctaacagtctgactgatgcggctgagcaa
gtagttaaagctgcggagggcaaataa

DBGET integrated database retrieval system