KEGG   Shewanella sp. MR-4: Shewmr4_1683Help
Entry
Shewmr4_1683      CDS       T00388                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
she  Shewanella sp. MR-4
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:she00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Shewmr4_1683
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shewmr4_1683
   00620 Pyruvate metabolism
    Shewmr4_1683
   00650 Butanoate metabolism
    Shewmr4_1683
  Lipid metabolism
   00071 Fatty acid degradation
    Shewmr4_1683
  Amino acid metabolism
   00350 Tyrosine metabolism
    Shewmr4_1683
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Shewmr4_1683
   00626 Naphthalene degradation
    Shewmr4_1683
Enzymes [BR:she01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Shewmr4_1683
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Shewmr4_1683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1993541..1996141)
Genome map
AA seq 866 aa AA seqDB search
MTVTNAQELDLMVERVAKAQAEYASFSQAQVDAIFRAAALAAADARISLAKMAAAETRMG
VIEDKVIKNHFASEYIYNKYKDEKTCGILSEDPTFGTITIAEPVGIICGIVPTTNPTSTA
IFKALISLKTRNAIIFSPHPRAKVSTTTAAKLVLDAAIAAGAPKDIIGWIDEPSVALSNQ
LMTHAKVNLILATGGPGMVKAAYSSGKPAIGVGAGNTPIVIDETADIKRAVSSILMSKTF
DNGVVCASEQAVIVVDSIYEQVKERFATHGGYLLNAAQTAAMQQVILKNGGLNADIVGQS
AATIAQMAGIDVPHTTKVLIGEVTDITEAEAFAHEKLSPLLGMYRAADFNDAVDKAEALV
ALGGIGHTSGLYTDQDTQTERVKTFGFRMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPSHLINKKTVAKRAENMLWHKLPSSIYFRRGSLPIALEELSDKKRA
LIVTDRFLFNQGYCDETLKILKAQGLETEVFYEVEADPTLATVRQGAKVANSFKPDVIIA
LGGGSPMDAAKIIWVMYEHPDVDFADLALRFMDIRKRIYKFPKMGVKATMVAIPTTSGTG
SEVTPFAVVTDEQTGKKYPIADYQLTPNMAIVDPNLVMDMPKSLTAFGGIDAITHALEAY
VSVMANEYSDGQALQALNLLCKYLPDAYQLGAASPIAREKVHNGATIAGIAFANAFLGIC
HSMAHKLGAEFHLAHGLANALLISNVIRFNATDLPTKQAAFSQYDRPKALCRYAAIADHL
ALGGSSDAEKVEKLLEKIEQLKKTLGIPASIQEAGVNEADFLAKLDELAEDAFDDQCTGA
NPRYPLISELKQLLLDSYYGRPFTEQ
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atgacagtaactaatgctcaagaactggatctcatggtcgagcgcgtcgccaaagcgcaa
gccgagtatgccagttttagccaagctcaagtcgatgccattttccgcgccgccgcactg
gccgccgccgatgcacgcatatcacttgcgaaaatggccgccgccgaaacccgaatgggg
gtgattgaagacaaagtgattaaaaaccactttgcctccgagtacatttacaacaagtac
aaagatgaaaagacctgcggaattttatccgaggaccccaccttcggcactatcactatc
gccgagcccgtgggcattatctgtgggattgtccccaccacaaatcccacctccaccgcc
atcttcaaagcattaatcagtcttaaaacccgtaatgcgattattttttcccctcaccca
agggcgaaagtctcaaccaccactgcggctaaattggtgctagatgccgcaattgccgcc
ggtgcgcccaaggacattatcggttggattgatgagcccagtgtggcactttccaatcaa
ttgatgacccatgctaaagtgaaccttatcctcgccacaggtggcccaggtatggtgaaa
gccgcctactcctccggcaaacctgccattggcgtgggtgcgggtaacacaccgattgtt
atcgatgaaaccgccgacataaaacgtgcggtcagctcgattttgatgtctaaaaccttc
gataacggcgtcgtctgtgcctcagagcaagcggtgattgtggtcgatagtatctacgaa
caagttaaagaacgctttgccacccatggcggttatctcttaaatgcggcacaaaccgcg
gcaatgcaacaagtcatccttaaaaatggcggcttaaatgccgatatcgtcggccaaagc
gccgcgaccatagcgcaaatggcgggcattgatgtcccccacaccaccaaggtcttaatt
ggtgaggtcaccgatatcacagaggcggaagcctttgcccacgaaaaactatccccatta
cttggcatgtaccgcgccgccgatttcaatgacgccgtcgataaggcagaagccttagtt
gccttaggcggtattggccacacatcaggcttatataccgaccaagacacccaaaccgag
cgggtgaaaacctttggttttagaatgaaaaccgcgcgaattctaatcaacactccagct
tcacaaggcggaattggcgatctgtacaactttaaactcgctccctcgctcaccttaggt
tgcggttcttggggcggaaactcgatttccgaaaacgtcggcccaagtcatttaattaat
aagaaaaccgtcgctaagagggctgaaaacatgctgtggcacaagcttccttcatctatc
tacttccgccgcggcagcttacctattgcgcttgaagaattgagcgataaaaaacgcgcc
ctcatagtgaccgacagattcctgtttaaccaaggttattgcgacgaaaccttaaagatt
ttaaaagcccaaggtcttgaaaccgaagtgttttacgaagtggaagccgaccccacactg
gccacagtgcgacaaggtgccaaagtggccaatagctttaaacccgatgtgattattgcc
ttaggcggtggctcgcccatggatgcggccaagattatttgggtgatgtacgagcatccc
gatgtcgactttgccgatttagccctgcgttttatggatatccgtaaacgtatctataaa
ttccctaaaatgggcgtcaaagccactatggtggcgatccccaccacatcaggcacaggc
tcagaggtcacaccgtttgccgtagtaaccgatgaacaaaccggtaaaaaataccccatc
gccgactatcaactcacccctaatatggcgattgttgacccgaatctggtgatggatatg
ccaaaatccttaaccgctttcggcgggatcgatgcgatcacccacgcgctcgaagcctat
gtcagtgtgatggcgaatgagtacagcgatggtcaagctctgcaagcactcaacctactg
tgcaaatatttacccgatgcttatcagcttggcgccgcatcccctatcgcccgagaaaaa
gtgcataatggtgcgaccatagccggtatcgcctttgccaacgccttccttgggatctgt
cactctatggcccataaactgggcgccgagtttcatttagcccatggacttgccaatgcg
ctactcatcagtaacgtgatccgctttaatgcgaccgatttacccactaagcaagccgca
ttcagccaatacgacaggcctaaagccctgtgtcgttacgcggccattgccgatcattta
gccttaggtggaagttcagatgcggaaaaagtcgagaaattgctggaaaaaatcgagcaa
ctcaagaagacgctgggcattccagcatctatccaagaagcgggagttaacgaagccgac
ttcctcgccaaactagacgagctcgccgaggatgccttcgatgaccaatgcactggcgcc
aaccctcgctatcctttgatcagtgagttaaaacaactactgctcgacagctactatggc
cgcccatttactgagcaatag

DBGET integrated database retrieval system