KEGG   Shewanella sp. MR-4: Shewmr4_1869Help
Entry
Shewmr4_1869      CDS       T00388                                 

Definition
glucan 1,4-alpha-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
she  Shewanella sp. MR-4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:she00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Shewmr4_1869
Enzymes [BR:she01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Shewmr4_1869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2223859..2226375)
Genome map
AA seq 838 aa AA seqDB search
MALTTVPSQQARSLTHRRNLTRKPIALAIAASIIGVASLTGCSPSAPNADTSTPTVTKAT
DAQIAPGAPGKAPTWAFSGKTGIGTSYEPYTQGQYQDSIQNPISRVWFSVAQGILTETMY
GLIHNAQLKELQFVITGNGFVDTEKDNTISSIEYLDTDANGRPQSLAYKIINRDVEGKYQ
IEKHIFTDPDRDTLMMRVTFTAFEAGITPHLYVNPHIDNAGANDIGRIDHQALIARTADP
HSSVMTVKSDIDFTQATTGFVGVSDGLADLGDNGKLDTLYQATSNAENPTQGNIAFTASY
PVLQANQALNVNLAIGFGHDETSSLANANASLTAGYDKVLSQYNAGWHSYLHSLPAMPDM
AQSTTDNGKLLYTSAMVLKAQEDKTYAGALIASLSNPWGDTVPAVTPSTGYKAVWPRDFY
QCAMAFLAMGDTQTPKVAFEYLKKVQVSDKTPGFSGTPGWFLQKTHVDGQIEWVGVQLDQ
TAMPIMLGWKLWQAGVLSQAELSHWYQEMLKAAADFLVSGGEVNLDWNHTQITPPKTQQE
RWEEQAGYSPSTTAAVIAGLVAASDIAKAVNDSDTSQRYLATAKTLNQQLEKHLVTTQGL
LTDSQGIKAPYYLRLSPNGEPNTAETLAANNGRAGLDQRQILDGGFLELVRYGVRGATDK
LINQSLALVDNTELEENLRLKYNFTAKDGSNVPGFRRYGNDGYGEDTLTGANYAESGSNS
DNQRGRVWPFFTGERGHFELALASAKGELTGTHAQQTKQQLINTYVQGMETFANAGLMLP
EQAWDGVGNATRYQYQLGQGTNSATPLAWTHAEYIKLVRSMSDGRVWDNYPIVPEALK
NT seq 2517 nt NT seq  +upstreamnt  +downstreamnt
atggcattgacaacagtaccttcgcagcaggctcgcagcttaactcaccgccgcaactta
actcgtaagccgattgcgctcgcaattgccgcaagcataatcggcgttgccagcttaacg
ggctgctcaccctcggcccccaatgcagacacatcaacaccaaccgtcacaaaagccaca
gacgcacagattgcccccggcgcccccggcaaagccccaacctgggcgttctccggcaaa
accggtatcggtacctcctatgagccttatactcaagggcaataccaagacagcatccaa
aatcccattagccgagtgtggttctccgtcgcacaggggattttaaccgagaccatgtac
ggccttattcacaacgctcagctcaaagagttgcaatttgtgatcacaggcaatggcttt
gtcgataccgaaaaagacaacactatcagcagcattgaatacttagataccgatgccaat
ggccgcccacaatccttggcctataagattatcaatcgcgatgttgaaggtaagtatcag
atagaaaaacatatctttaccgatcccgaccgcgatacgctgatgatgcgcgtgacgttt
accgcctttgaagcaggcatcacaccgcatttatacgttaacccccatatcgataatgcg
ggcgcgaatgatattggcagaatcgatcatcaagcccttatcgctcgcaccgccgatccc
cacagcagcgtaatgacagttaaatcggatatcgattttacgcaggcgactacgggcttt
gtcggtgtatccgacggtttggccgatttaggcgataacggcaagcttgatacgctgtat
caggccaccagcaacgccgaaaatcctactcaaggcaacattgcctttaccgccagttat
cccgtactccaagcgaatcaagctcttaatgtgaatttggcgattggttttggccatgat
gaaacgagcagtttagccaatgccaacgccagcttaacggcggggtatgacaaagtgctg
agccaatacaacgctggttggcacagttatttacactcgctacccgcgatgcctgatatg
gcgcaaagcaccacagataatggcaagctgctgtataccagtgccatggtacttaaggcg
caggaagataaaacctacgctggcgcccttatcgcgtcgctttctaatccttggggcgat
accgtacctgctgtcacacccagcacgggctacaaggccgtttggccccgtgacttttac
cagtgcgccatggcatttctcgccatgggcgatacgcaaacgcctaaagtcgcctttgag
taccttaaaaaggtgcaagtgagtgacaaaactccaggctttagcggcacgcccggttgg
tttttacaaaagactcatgtggatggccaaatcgaatgggttggcgtacagctcgaccaa
acggcgatgccgatcatgctcggctggaaactctggcaggcaggcgtactcagccaagcg
gaactgagccattggtatcaagagatgctaaaagctgcggcggactttttagtcagcggc
ggcgaggtgaatcttgactggaatcacacgcaaattacgccaccgaaaacccagcaagaa
cgttgggaagaacaagctggttattcgccctccaccacggccgcagttatcgcaggttta
gtggctgcgagtgatattgctaaggcagtaaacgacagcgataccagtcagcgttatctc
gcaaccgctaaaacgcttaatcaacaacttgaaaaacacttagtgacgacccaaggtttg
cttaccgatagccaaggcattaaggcgccttattatctgcgattaagccccaacggtgag
ccaaacaccgccgagacactcgccgcgaataatggtcgtgcgggattagatcaacgtcag
atcctcgatggcggctttttagaactggtgcgctacggcgtgcgtggcgcaaccgataag
ctgattaatcaaagcctagcgctggtggataacactgagcttgaggaaaatttacgcctc
aaatacaactttactgccaaagatggcagcaacgttcccggctttaggcgttacggtaac
gatggctacggtgaagataccctcactggcgcaaactacgccgaatcaggcagtaatagc
gacaaccaacgcggccgcgtctggcccttcttcaccggcgagcgtggtcattttgaattg
gccctcgctagcgccaagggagagctaacgggtactcacgcgcagcaaaccaaacagcag
cttatcaatacctatgtgcaagggatggaaaccttcgccaacgcgggtctgatgctcccc
gagcaagcgtgggacggtgtgggtaacgccacacgttaccaatatcaactcggccaaggc
actaactccgccaccccactcgcttggacccacgctgaatatatcaagctggtacgttca
atgagcgacggtcgagtctgggataactatccaatcgtcccagaagcgttgaaataa

DBGET integrated database retrieval system