KEGG   Shewanella sp. MR-4: Shewmr4_2102Help
Entry
Shewmr4_2102      CDS       T00388                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
she  Shewanella sp. MR-4
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2506435..2507361)
Genome map
AA seq 308 aa AA seqDB search
MSSSAANKELDSAAQILRLAVPQMSALDIPVTPENYTVWYEYFAQSNLDLNRAIDGFLAN
KVVFTKEVNTSLYKNFIQEKSPEVIENVQIETQILINSLISKISQLTQGTEAFSSTLADF
GLQLQSTPDVCTLNQLVGGVIDEMQNLLINNQNMEQSLTAMGQEVQNLKSEMENLSLAAM
TDQLTSLHNRRAYEIAIQDHIHRAEEQQTRCSLLLIDIDRFKLFNDTYGHQVGDKVLAYV
ALALKQCVRGDDFVARYGGEEFVVVLPNTHFHDALQVAETLRERISERRLAIGKDKKLSL
GAITVSIG
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcttctgcagcaaataaagagctcgattcggcggcgcaaatcctgcgattagcc
gtgccacaaatgtctgcgcttgatattcccgtgacccccgaaaactacacggtttggtat
gagtattttgcccagtcaaacctcgacttaaatcgcgccattgatggctttctggcaaac
aaagtggtgtttaccaaagaggtgaataccagcctgtacaagaattttattcaagaaaaa
tccccagaagtgattgagaatgtccaaattgaaactcaaatattgatcaactcactgatc
agtaaaatttctcagttaacccaagggactgaggccttttcaagtaccctggcggacttt
ggactgcaactgcaatcgacccccgatgtctgcaccttgaaccaattagtgggtggggtg
atagatgaaatgcaaaatctcttaatcaacaaccagaacatggagcaaagcttaacggcc
atggggcaagaggtgcagaacttaaaatccgagatggagaacctaagtttagcggccatg
acagatcaattgacctctctgcataaccgccgcgcctacgagattgccattcaagatcat
attcaccgcgcggaggagcagcaaacccgttgtagcctgttactcatcgatattgaccgc
tttaaattgtttaacgacacctatggccatcaagtgggggataaggtgttagcctatgtt
gcgctcgccctcaaacaatgtgtgcggggggatgactttgtcgcccgctatggcggtgaa
gaatttgtggtggtgttgcctaacactcatttccacgatgcgctccaagtggccgaaacc
ttaagggagcgtatctcagagcggcgtttagccataggcaaagataaaaaactctcccta
ggcgcgattacagtgtctatcggctaa

DBGET integrated database retrieval system