KEGG   Shewanella sp. MR-4: Shewmr4_2198Help
Entry
Shewmr4_2198      CDS       T00388                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
she  Shewanella sp. MR-4
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2626053..2627078
Genome map
AA seq 341 aa AA seqDB search
MSRDLLQTAALNLKKAVPLMLKHQIPTTPINYALWYTYVGEQNPALNAQLDTVIAHYNTC
PPVSSELLFRQYVADPVELDVRDMRLNLEAMATELSQSIRDTNLDATEFQSCINTNFAKL
NGIEEGALSVEQVLDLVRNLVKESENIRSSTEFFTAQLQKAQTEIDALKQKLEKTEKDVL
YDALTGCLNRRAFDADIAGMLAQAPEGTCLIFVDIDHFKAFNDNYGHQLGDQVLKAVAKR
LQEACRDGCKLYRFGGEEFAIVVPKSQLRIARQLAEAMRRGLEKLSLKDRRKDQRIDHIT
ASFGVAQWQEKQSVMQLIEKTDKLLYEAKRLGRNRVMPISN
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgagatttattacaaaccgcagccttgaatcttaaaaaagcggttcccttaatg
ctcaaacatcaaattcccaccacgccaatcaattatgccctctggtatacctatgttggg
gaacaaaacccagcactcaatgcccagcttgatactgtgattgctcactacaacacctgc
ccgcccgtgagcagcgagttgttgttccgccagtatgtcgcagatccagttgagctggat
gtacgcgatatgcggctaaaccttgaggccatggccacagaattatcgcaatcaattcgg
gataccaatctggatgcaactgagttccaaagctgtattaacactaactttgccaaactc
aatggcatcgaagaaggtgcgctcagtgttgagcaagtgctcgatttagtacgcaattta
gtcaaagaatccgagaatattcgctcaagtaccgagttttttactgcccaattacaaaaa
gcccagacagagattgatgcgctgaagcaaaagctcgaaaaaaccgaaaaagatgtactg
tatgacgcgctgaccggctgtttaaaccgccgcgctttcgacgccgatatcgccggcatg
ttggctcaggcgcccgagggcacctgtcttatctttgtcgatatcgatcactttaaggcc
tttaatgataattacggccaccagctaggcgatcaagtattaaaagcggtggcaaagcgc
ttgcaggaagcctgtcgtgatggctgtaagttataccgcttcggtggcgaagagttcgcg
attgtggtgcctaagagccaactgcgtattgcgcggcaactggctgaagccatgcgccgc
ggccttgaaaaactcagcctcaaggatagacgtaaggatcaacgtatcgatcatatcacc
gcctcctttggtgtcgcccagtggcaagaaaagcaatccgtaatgcaactgattgaaaaa
acagataagttgctttacgaggccaaacgcctaggccgcaaccgagtcatgccgataagc
aactaa

DBGET integrated database retrieval system