KEGG   Shewanella sp. MR-4: Shewmr4_2252Help
Entry
Shewmr4_2252      CDS       T00388                                 

Definition
(GenBank) DNA replication and repair protein RecR
  KO
K06187  recombination protein RecR
Organism
she  Shewanella sp. MR-4
Pathway
she03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:she00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Shewmr4_2252
DNA repair and recombination proteins [BR:she03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Shewmr4_2252
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Shewmr4_2252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH_5 Nop10p HHH
Motif
Other DBs
NCBI-ProteinID: ABI39323
JGI: Shewmr42252
UniProt: Q0HHZ4
Position
complement(2694479..2695078)
Genome map
AA seq 199 aa AA seqDB search
MKFSPLLDELIQSLRCLPGVGPKSAQRMAFQLLERDRKAGLKLASALSSAMSDIGHCQSC
RTYTEESLCPICASHKRGSSSTICVVETPADVLAIEAGGHFSGRYFVLLGHLSPLDGVGP
EELGLALLERHLASGDVAELILATNPTVEGEATAHFIADMARRHKVVISRIAHGVPVGGE
LEYVDSTTLALSFNGRIPL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttagtccactgcttgacgagttaattcagtccctgcgctgtttgcctggggtt
gggccgaaatcggctcaacgtatggcgtttcaattgcttgagcgcgatagaaaggccggg
cttaaattagcctcggcgctgtcgagtgccatgagcgatatcggtcattgtcagtcttgt
cgaacctacactgaagaaagcctctgtccgatttgtgctagccataaacgcggctcctcg
tcgacgatttgtgtggtcgaaacaccggccgatgtattagccattgaagcgggtggacat
ttttctggtcgctactttgtattgctcggtcatttatcccccctcgatggggtggggcct
gaagagttaggcttggcgctattagagcgtcacttagcctcgggcgatgttgccgagctt
atcctcgcgaccaatccaacggtagaaggtgaggccaccgcccactttattgccgatatg
gcacggcgccataaggtggtgatcagccgcatcgcccacggtgttcccgtgggtggcgag
ctggaatatgtcgacagcaccaccttagcactgtccttcaatgggcgtatcccgctgtag

DBGET integrated database retrieval system