KEGG   Shewanella sp. MR-4: Shewmr4_2705Help
Entry
Shewmr4_2705      CDS       T00388                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
she  Shewanella sp. MR-4
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:she00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:she00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3225298..3225783
Genome map
AA seq 161 aa AA seqDB search
MTSTIYSHSANDIQGNPTALAQYQGKVILIVNTASECGFTPQYKGLEALYQKYKAQGLVV
LGFPCNQFGAQEKADEKGIQSFCELNFGVSFPLFSKIEVNGEHTHPLYQYLKKAAPGVLG
TERIKWNFTKFLVNRQGEVVARFAPTTKPEAISDKIEALLK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgactatctatagccatagcgcaaacgacattcaaggtaatccaacggcactg
gcgcaatatcaaggcaaagtgatcttaattgtgaacaccgccagtgagtgcggttttaca
ccacagtacaagggcttagaagcgctctatcaaaaatataaagcgcagggattggtggtt
ttaggcttcccatgcaatcagtttggcgcccaagaaaaagccgatgagaaaggtattcaa
agtttttgtgaactcaactttggcgtgagctttccactgttttcgaaaatcgaggtaaac
ggtgagcacactcaccctttataccagtacctcaaaaaagcggctccaggcgtattaggc
acggaacgcattaagtggaatttcactaaattcttagttaatcgtcagggcgaagtggtc
gctcgctttgcgccaaccacaaaaccagaggccattagtgacaagatagaagcgctttta
aaataa

DBGET integrated database retrieval system